Comparing GFF1143 PGA1_c11580 octopine permease ATP-binding protein P to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
56% identity, 96% coverage: 8:255/259 of query aligns to 3:252/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
56% identity, 96% coverage: 8:255/259 of query aligns to 7:256/258 of P02915
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
47% identity, 95% coverage: 10:254/259 of query aligns to 4:238/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
49% identity, 97% coverage: 6:257/259 of query aligns to 1:241/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
48% identity, 96% coverage: 7:255/259 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
48% identity, 96% coverage: 7:255/259 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
48% identity, 96% coverage: 7:255/259 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
48% identity, 96% coverage: 7:255/259 of query aligns to 3:241/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 95% coverage: 13:257/259 of query aligns to 11:246/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 95% coverage: 13:257/259 of query aligns to 12:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 95% coverage: 13:257/259 of query aligns to 12:247/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 95% coverage: 13:257/259 of query aligns to 12:247/344 of 6cvlD
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 82% coverage: 5:216/259 of query aligns to 2:208/648 of P75831
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 84% coverage: 7:224/259 of query aligns to 3:215/226 of 5xu1B
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 96% coverage: 5:252/259 of query aligns to 15:248/378 of P69874
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
35% identity, 93% coverage: 7:246/259 of query aligns to 4:239/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
36% identity, 75% coverage: 21:215/259 of query aligns to 17:202/223 of 2pclA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
37% identity, 81% coverage: 7:216/259 of query aligns to 3:207/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 81% coverage: 7:216/259 of query aligns to 3:207/592 of 5lj7A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 87% coverage: 31:255/259 of query aligns to 50:266/382 of 7ahhC
Sites not aligning to the query:
>GFF1143 PGA1_c11580 octopine permease ATP-binding protein P
MTDTTPVLEIRGLHKSYGELEVIKGVDITAHRGDVVSLIGSSGSGKSTLLRCCNLLEDSQ
EGDILFKGEPINWSGTGLARRPSDAKQVLRIRTNLSMVFQQFNLWAHMTILQNVMEAPLT
VLGRDRAEVEDAARKYLTKVGIGDKCDAYPAQLSGGQQQRAAIARALCMEPEALLFDEPT
SALDPELEQEVVKVIKDLAAEGRTMIIVTHDMNMAADVSSHIVFLHKGLIEEEGCPDEVF
GSTRSERLRGFLASTRHGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory