SitesBLAST
Comparing GFF1146 FitnessBrowser__psRCH2:GFF1146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
42% identity, 91% coverage: 3:272/296 of query aligns to 15:284/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (≠ T9), G22 (= G10), I23 (= I11), M24 (= M12), N43 (≠ L29), R44 (≠ S30), T45 (= T31), K48 (≠ D34), V77 (= V65), S78 (≠ P66), D82 (≠ H70), Q85 (≠ D73), V133 (= V121), F244 (= F232), K245 (≠ R233), H248 (≠ L236), K251 (= K239)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
42% identity, 91% coverage: 3:272/296 of query aligns to 15:281/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (≠ T9), G22 (= G10), I23 (= I11), M24 (= M12), N43 (≠ L29), R44 (≠ S30), T45 (= T31), K48 (≠ D34), M76 (= M64), V77 (= V65), S78 (≠ P66), D82 (≠ H70), Q85 (≠ D73), V133 (= V121), F241 (= F232), K242 (≠ R233), H245 (≠ L236), K248 (= K239)
- binding sulfate ion: T134 (≠ S122), G135 (= G123), K183 (= K171)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
37% identity, 96% coverage: 1:283/296 of query aligns to 1:284/298 of P0A9V8
- QM 11:12 (≠ IM 11:12) binding
- D31 (≠ T31) binding
- L65 (≠ V65) binding
- T96 (≠ S96) binding
- G122 (≠ S122) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G123) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G124) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQII- 174:177) binding
- K240 (= K239) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
37% identity, 95% coverage: 2:283/296 of query aligns to 1:283/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ I11), M11 (= M12), F29 (≠ S30), D30 (≠ T31), V31 (≠ H32), M63 (= M64), L64 (≠ V65), V73 (= V74), S94 (= S95), T95 (≠ S96), R122 (≠ G123)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
37% identity, 95% coverage: 2:283/296 of query aligns to 1:283/294 of 6smyA
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
33% identity, 97% coverage: 4:291/296 of query aligns to 41:335/335 of P29266
- D68 (≠ T31) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K171) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q175) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
33% identity, 97% coverage: 4:291/296 of query aligns to 42:336/336 of P31937
- LP 103:104 (≠ VP 65:66) binding
- N108 (≠ H70) binding
- T134 (≠ S96) binding
- K284 (= K239) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
33% identity, 96% coverage: 1:283/296 of query aligns to 3:287/294 of 5je8B
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
33% identity, 96% coverage: 4:287/296 of query aligns to 3:293/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (≠ I11), M11 (= M12), Y29 (≠ H33), D30 (= D34), V31 (≠ A35), M63 (= M64), L64 (≠ V65), P65 (= P66), T95 (≠ S96), V120 (= V121), G122 (= G123), F238 (= F232), K245 (= K239)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 97% coverage: 1:286/296 of query aligns to 1:286/287 of 3pduA
- binding glycerol: R242 (≠ N242), E246 (≠ A246), E246 (≠ A246), R250 (≠ E250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (= I11), M12 (= M12), N31 (≠ T31), R32 (≠ H32), N33 (≠ H33), M64 (= M64), L65 (≠ V65), A66 (≠ P66), A70 (≠ H70), T96 (≠ S96), V121 (= V121), G123 (= G123), T124 (≠ G124), K171 (= K171), S231 (≠ G231), F232 (= F232), P233 (≠ R233), H236 (≠ L236), K239 (= K239)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
31% identity, 96% coverage: 3:287/296 of query aligns to 3:287/287 of 3pefA
- binding glycerol: D67 (= D67), G123 (= G123), K171 (= K171), N175 (≠ Q175), M178 (≠ V178), L203 (≠ R203), G207 (≠ M207), N213 (≠ S213), A217 (≠ E217), F232 (= F232), H236 (≠ L236), K239 (= K239), R242 (≠ N242), R269 (≠ A269)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (= I11), M12 (= M12), N31 (≠ T31), R32 (≠ H32), S33 (≠ H33), K36 (≠ A36), M64 (= M64), L65 (≠ V65), A66 (≠ P66), A70 (≠ H70), E73 (≠ D73), T96 (≠ S96), V121 (= V121), G123 (= G123), S124 (≠ G124), A231 (≠ G231), F232 (= F232), H236 (≠ L236), K239 (= K239)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 82% coverage: 1:243/296 of query aligns to 1:250/298 of Q9I5I6
- 2:31 (vs. 2:31, 50% identical) binding
- P66 (= P66) binding
- T96 (≠ S96) binding ; mutation to A: Almost abolished activity.
- S122 (= S122) mutation to A: Strongly reduced activity.
- K171 (= K171) active site
- N175 (≠ Q175) mutation to A: Strongly reduced activity.
- W214 (≠ K214) mutation to A: Almost abolished activity.
- Y219 (≠ H219) mutation to A: Strongly reduced activity.
- K246 (= K239) binding ; mutation to A: Almost abolished activity.
- D247 (= D240) mutation to A: Almost abolished activity.
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 96% coverage: 3:287/296 of query aligns to 8:292/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G10), L16 (≠ I11), M17 (= M12), N36 (≠ T31), R37 (≠ H32), T38 (≠ H33), V70 (= V65), S71 (≠ P66), A75 (≠ H70), T101 (≠ S96), F237 (= F232), Y238 (≠ R233), Y241 (≠ L236), K244 (= K239)
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
37% identity, 81% coverage: 3:243/296 of query aligns to 2:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), H10 (≠ I11), M11 (= M12), F29 (≠ S30), D30 (≠ T31), L31 (≠ H32), M63 (= M64), L64 (≠ V65), P65 (= P66), T94 (≠ S96), V119 (= V121), G121 (= G123), F237 (= F232), K244 (= K239)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 99% coverage: 1:294/296 of query aligns to 1:289/289 of 2cvzC
- active site: S117 (= S122), K165 (= K171), N168 (= N174), N169 (≠ Q175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (≠ T9), G10 (= G10), A11 (≠ I11), M12 (= M12), N30 (≠ S30), R31 (≠ T31), T32 (≠ H32), C62 (≠ M64), L63 (≠ V65), P64 (= P66), E68 (≠ H70), E71 (≠ D73), S91 (= S96), V116 (= V121), F227 (= F232), K234 (= K239)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 96% coverage: 3:287/296 of query aligns to 269:553/553 of Q49A26
- 271:285 (vs. 5:19, 47% identical) binding
- T362 (≠ S96) binding
- M437 (≠ K171) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P230) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K239) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
36% identity, 82% coverage: 1:243/296 of query aligns to 1:249/295 of 3obbA
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
31% identity, 99% coverage: 3:294/296 of query aligns to 2:288/288 of 1wp4A
- active site: S116 (= S122), K164 (= K171), N167 (= N174), N168 (≠ Q175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (≠ T9), G9 (= G10), A10 (≠ I11), M11 (= M12), N29 (≠ S30), R30 (≠ T31), T31 (≠ H32), K34 (≠ A35), C61 (≠ M64), L62 (≠ V65), P63 (= P66), E67 (≠ H70), S90 (= S96), V115 (= V121), T225 (≠ G231), F226 (= F232), K233 (= K239)
- binding sulfate ion: S116 (= S122), G117 (= G123), G118 (= G124), K164 (= K171)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
27% identity, 96% coverage: 3:287/296 of query aligns to 268:546/546 of Q922P9
- P489 (= P230) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 94% coverage: 4:282/296 of query aligns to 318:597/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
Query Sequence
>GFF1146 FitnessBrowser__psRCH2:GFF1146
MAKIGFIGTGIMGLPMAQNLQKAGHDIFLSTHHDAAPAALIEAGAVALANPKEVAQEAEF
IIVMVPDTPHVEDVLFRENGIAEGVGPNKLVIDMSSISPSATKTFAEKINATGAQYLDAP
VSGGEVGAKAATLSIMVGGSEESFARALPLFQAMGKNITLVGGNGDGQTAKVANQIIVAL
NIQAVAEALLFAARNGADPAKVREALMGGFAGSKILEVHGERMIKGTFDPGFRISLHQKD
LNLALAGARELGLNLPNTANAQQVFSTCAAIGGSGWDHSALIKGLEHMANFSIRKE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory