SitesBLAST
Comparing GFF1164 FitnessBrowser__Marino:GFF1164 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
49% identity, 96% coverage: 2:248/257 of query aligns to 1:247/247 of 7borA
- active site: N63 (= N64), F68 (= F69), D77 (≠ Q79), G81 (= G83), I105 (= I107), T108 (= T110), F128 (= F130), L133 (= L135), P135 (= P137), E136 (= E138), A222 (≠ L223), L232 (= L233)
- binding coenzyme a: D21 (≠ E22), K22 (≠ R23), A25 (= A26), S61 (≠ A62), I65 (≠ L66), V103 (= V105), F128 (= F130), L131 (= L133), F244 (= F245), R247 (≠ K248)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 98% coverage: 4:254/257 of query aligns to 4:255/257 of 6slbAAA
- active site: Q64 (≠ N64), F69 (= F69), L80 (vs. gap), N84 (≠ G83), A108 (≠ I107), S111 (≠ T110), A130 (≠ P129), F131 (= F130), L136 (= L135), P138 (= P137), D139 (≠ E138), A224 (≠ L223), G234 (≠ L233)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ E58), A62 (= A62), Q64 (≠ N64), D65 (= D65), L66 (= L66), Y76 (≠ F77), A108 (≠ I107), F131 (= F130), D139 (≠ E138)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 98% coverage: 4:254/257 of query aligns to 1:243/245 of 6slaAAA
- active site: Q61 (≠ N64), L68 (≠ Q79), N72 (≠ G83), A96 (≠ I107), S99 (≠ T110), A118 (≠ P129), F119 (= F130), L124 (= L135), P126 (= P137), N127 (≠ E138), A212 (≠ L223), G222 (≠ L233)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ K24), A59 (= A62), Q61 (≠ N64), D62 (= D65), L63 (= L66), L68 (≠ Q79), Y71 (≠ V82), A94 (≠ V105), G95 (= G106), A96 (≠ I107), F119 (= F130), I122 (≠ L133), L124 (= L135), N127 (≠ E138), F234 (= F245), K237 (= K248)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 97% coverage: 5:254/257 of query aligns to 5:250/250 of 3q0gD
- active site: A64 (≠ N64), M69 (vs. gap), T75 (≠ P74), F79 (≠ E78), G103 (≠ I107), E106 (≠ T110), P125 (= P129), E126 (≠ F130), V131 (≠ L135), P133 (= P137), G134 (≠ E138), L219 (= L223), F229 (≠ L233)
- binding Butyryl Coenzyme A: F225 (= F229), F241 (= F245)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 98% coverage: 5:255/257 of query aligns to 5:255/256 of 3h81A
- active site: A64 (≠ N64), M69 (vs. gap), T79 (≠ P74), F83 (≠ E78), G107 (≠ I107), E110 (≠ T110), P129 (= P129), E130 (≠ F130), V135 (≠ L135), P137 (= P137), G138 (≠ E138), L223 (= L223), F233 (≠ L233)
- binding calcium ion: F233 (≠ L233), Q238 (≠ A238)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 97% coverage: 5:254/257 of query aligns to 6:255/255 of 3q0jC
- active site: A65 (≠ N64), M70 (vs. gap), T80 (≠ P74), F84 (≠ E78), G108 (≠ I107), E111 (≠ T110), P130 (= P129), E131 (≠ F130), V136 (≠ L135), P138 (= P137), G139 (≠ E138), L224 (= L223), F234 (≠ L233)
- binding acetoacetyl-coenzyme a: Q23 (≠ E22), A24 (≠ R23), L25 (≠ K24), A27 (= A26), A63 (= A62), G64 (= G63), A65 (≠ N64), D66 (= D65), I67 (≠ L66), K68 (≠ G67), M70 (vs. gap), F84 (≠ E78), G107 (= G106), G108 (≠ I107), E111 (≠ T110), P130 (= P129), E131 (≠ F130), P138 (= P137), G139 (≠ E138), M140 (≠ G139)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 97% coverage: 5:254/257 of query aligns to 6:255/255 of 3q0gC
- active site: A65 (≠ N64), M70 (vs. gap), T80 (≠ P74), F84 (≠ E78), G108 (≠ I107), E111 (≠ T110), P130 (= P129), E131 (≠ F130), V136 (≠ L135), P138 (= P137), G139 (≠ E138), L224 (= L223), F234 (≠ L233)
- binding coenzyme a: L25 (≠ K24), A63 (= A62), I67 (≠ L66), K68 (≠ G67), Y104 (≠ A103), P130 (= P129), E131 (≠ F130), L134 (= L133)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
32% identity, 99% coverage: 3:256/257 of query aligns to 13:269/273 of Q5HH38
- R34 (≠ K24) binding in other chain
- SGGDQ 73:77 (≠ AGNDL 62:66) binding in other chain
- S149 (≠ L135) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
32% identity, 99% coverage: 3:256/257 of query aligns to 8:256/260 of 2uzfA
- active site: G70 (≠ N64), R80 (vs. gap), L84 (≠ G83), G108 (≠ I107), V111 (≠ T110), T130 (≠ P129), G131 (≠ F130), S136 (≠ L135), D138 (≠ P137), A139 (≠ E138), A225 (≠ M222), Y233 (≠ L233)
- binding acetoacetyl-coenzyme a: V28 (≠ R23), R29 (≠ K24), S68 (≠ A62), G69 (= G63), G70 (≠ N64), D71 (= D65), Y104 (≠ A103), G108 (≠ I107)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 96% coverage: 6:253/257 of query aligns to 11:263/266 of O53561
- K135 (≠ A125) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 125:132, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ S132) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
27% identity, 98% coverage: 3:254/257 of query aligns to 4:257/259 of 5zaiC
- active site: A65 (≠ N64), F70 (= F69), S82 (≠ T80), R86 (= R84), G110 (≠ I107), E113 (≠ T110), P132 (= P129), E133 (≠ F130), I138 (≠ L135), P140 (= P137), G141 (≠ E138), A226 (≠ R219), F236 (= F229)
- binding coenzyme a: K24 (≠ R23), L25 (≠ K24), A63 (= A62), G64 (= G63), A65 (≠ N64), D66 (= D65), I67 (≠ L66), P132 (= P129), R166 (≠ A163), F248 (= F245), K251 (= K248)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
31% identity, 94% coverage: 12:253/257 of query aligns to 20:265/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
28% identity, 97% coverage: 5:254/257 of query aligns to 4:256/258 of 1ey3A
- active site: A66 (≠ N64), M71 (≠ F69), S81 (≠ V82), L85 (= L86), G109 (≠ I107), E112 (≠ T110), P131 (= P129), E132 (≠ F130), T137 (≠ L135), P139 (= P137), G140 (≠ E138), K225 (≠ L223), F235 (≠ L233)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E22), L26 (≠ K24), A28 (= A26), A64 (= A62), G65 (= G63), A66 (≠ N64), D67 (= D65), I68 (≠ L66), L85 (= L86), W88 (≠ L89), G109 (≠ I107), P131 (= P129), L135 (= L133), G140 (≠ E138)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
28% identity, 97% coverage: 5:254/257 of query aligns to 6:258/260 of 1dubA
- active site: A68 (≠ N64), M73 (≠ F69), S83 (≠ V82), L87 (= L86), G111 (≠ I107), E114 (≠ T110), P133 (= P129), E134 (≠ F130), T139 (≠ L135), P141 (= P137), G142 (≠ E138), K227 (≠ L223), F237 (≠ L233)
- binding acetoacetyl-coenzyme a: K26 (≠ E22), A27 (≠ R23), L28 (≠ K24), A30 (= A26), A66 (= A62), A68 (≠ N64), D69 (= D65), I70 (≠ L66), Y107 (≠ A103), G110 (= G106), G111 (≠ I107), E114 (≠ T110), P133 (= P129), E134 (≠ F130), L137 (= L133), G142 (≠ E138), F233 (= F229), F249 (= F245)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 97% coverage: 5:254/257 of query aligns to 36:288/290 of P14604
- E144 (≠ T110) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F130) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
30% identity, 94% coverage: 13:253/257 of query aligns to 25:268/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
5du6A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk059a. (see paper)
33% identity, 94% coverage: 13:254/257 of query aligns to 11:240/242 of 5du6A
- active site: A61 (≠ N64), P71 (= P74), I75 (≠ L86), A99 (≠ I107), Q102 (≠ T110), P121 (= P129), T122 (≠ F130), L127 (= L135), L129 (≠ P137), D130 (≠ E138), P209 (≠ L223), W219 (≠ L233)
- binding (5R,7R)-5-(4-ethylphenyl)-N-(4-fluorobenzyl)-7-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L74 (≠ F85), D82 (≠ A90), D130 (≠ E138), W132 (≠ G140), A207 (≠ T221), K212 (≠ G226), F215 (= F229)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
27% identity, 93% coverage: 15:254/257 of query aligns to 19:258/260 of 2hw5C
- active site: A68 (≠ N64), M73 (≠ F69), S83 (≠ Q79), L87 (≠ G83), G111 (≠ I107), E114 (≠ T110), P133 (= P129), E134 (≠ F130), T139 (≠ L135), P141 (= P137), G142 (≠ E138), K227 (≠ L223), F237 (≠ L233)
- binding crotonyl coenzyme a: K26 (≠ E22), A27 (≠ R23), L28 (≠ K24), A30 (= A26), K62 (≠ E58), I70 (≠ L66), F109 (≠ V105)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 13:257/257 of query aligns to 87:334/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
5dufA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk729a (see paper)
32% identity, 94% coverage: 13:254/257 of query aligns to 12:243/245 of 5dufA
- active site: A62 (≠ N64), D67 (vs. gap), P74 (= P74), I78 (≠ L86), A102 (≠ I107), Q105 (≠ T110), P124 (= P129), T125 (≠ F130), L130 (= L135), L132 (≠ P137), D133 (≠ E138), P212 (≠ L223), W222 (≠ L233)
- binding (5R,7S)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxylic acid: L77 (≠ F85), I78 (≠ L86), H81 (vs. gap), D85 (≠ A90), Q105 (≠ T110), D133 (≠ E138), W135 (≠ G140)
Query Sequence
>GFF1164 FitnessBrowser__Marino:GFF1164
MTDLVLTEIKARILIVRLNRPERKNALTHAMYTAMGDALEQARDDANIRCVLFTGSSECF
TAGNDLGEFAAGLPGDFEQTPVGRFLLLLASATKPVVASVNGAAVGIGTTMLLHCDLVFA
GNNTAFQMPFASLGLCPEGGSSLLLPSWIGRVRSAELLMLGGAFSAEEALRLGLINRVCE
PEQTDANAFEACQRLTEKAPAAIRATKALLNKPTIEALRETMLEEGQLFAERLKSPEAAE
AFRAFMEKRAPDFSRFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory