SitesBLAST
Comparing GFF1172 PGA1_c11870 serine hydroxymethyltransferase GlyA to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n0wA X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
65% identity, 96% coverage: 15:429/432 of query aligns to 9:415/416 of 4n0wA
- active site: Y57 (= Y63), E59 (= E65), D202 (= D209), T228 (= T235), K231 (= K238), R237 (= R244)
- binding pyridoxal-5'-phosphate: S99 (= S105), G100 (= G106), S101 (= S107), H128 (= H134), D202 (= D209), A204 (= A211), H205 (= H212), K231 (= K238)
4ot8A X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and serine
65% identity, 96% coverage: 15:429/432 of query aligns to 7:413/414 of 4ot8A
- active site: Y55 (= Y63), E57 (= E65), D200 (= D209), T226 (= T235), K229 (= K238), R235 (= R244)
- binding pyridoxal-5'-phosphate: S97 (= S105), G98 (= G106), S99 (= S107), H126 (= H134), D200 (= D209), A202 (= A211), H203 (= H212), K229 (= K238)
- binding serine: S35 (= S43), E57 (= E65), Y65 (= Y73), H126 (= H134), H203 (= H212), R360 (= R370)
4otlA X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and glycine
65% identity, 96% coverage: 15:429/432 of query aligns to 2:408/409 of 4otlA
- active site: Y50 (= Y63), E52 (= E65), D195 (= D209), T221 (= T235), K224 (= K238), R230 (= R244)
- binding glycine: S30 (= S43), Y50 (= Y63), Y60 (= Y73), H121 (= H134), K224 (= K238), R355 (= R370)
- binding pyridoxal-5'-phosphate: S92 (= S105), G93 (= G106), S94 (= S107), H121 (= H134), S170 (= S184), D195 (= D209), A197 (= A211), H198 (= H212), K224 (= K238)
6ymfA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the plp-serine external aldimine state (see paper)
60% identity, 96% coverage: 16:431/432 of query aligns to 7:416/418 of 6ymfA
- active site: Y54 (= Y63), E56 (= E65), D200 (= D209), T226 (= T235), K229 (= K238), R235 (= R244)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S34 (= S43), S96 (= S105), G97 (= G106), A98 (≠ S107), H125 (= H134), S175 (= S184), D200 (= D209), A202 (= A211), H203 (= H212), T226 (= T235), K229 (= K238), R361 (= R370)
6ymdA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the covalent complex with malonate (see paper)
60% identity, 96% coverage: 16:431/432 of query aligns to 7:416/420 of 6ymdA
- active site: Y54 (= Y63), E56 (= E65), D200 (= D209), T226 (= T235), K229 (= K238), R235 (= R244)
- binding malonate ion: S34 (= S43), Y54 (= Y63), E56 (= E65), Y64 (= Y73), H125 (= H134), H203 (= H212), K229 (= K238), R361 (= R370)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: Y54 (= Y63), S96 (= S105), G97 (= G106), A98 (≠ S107), H125 (= H134), Y174 (≠ G183), S175 (= S184), D200 (= D209), A202 (= A211), T226 (= T235), K229 (= K238), G261 (= G270)
Q5SI56 Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
63% identity, 88% coverage: 15:393/432 of query aligns to 3:381/407 of Q5SI56
- Y51 (= Y63) binding
- GS 94:95 (= GS 106:107) binding
- S172 (= S184) binding
- H200 (= H212) binding
- H225 (= H237) binding
- K226 (= K238) modified: N6-(pyridoxal phosphate)lysine
- G258 (= G270) binding
8suiB Joint x-ray/neutron structure of thermus thermophilus serine hydroxymethyltransferase (tthshmt) in internal aldimine state with l- ser bound in a pre-michalis complex (see paper)
64% identity, 87% coverage: 18:393/432 of query aligns to 1:376/402 of 8suiB
8ssyA Room-temperature x-ray structure of thermus thermophilus serine hydroxymethyltransferase (shmt) bound with d-ser in a pseudo- michaelis complex (see paper)
64% identity, 87% coverage: 18:393/432 of query aligns to 1:376/402 of 8ssyA
2dkjA Crystal structure of t.Th.Hb8 serine hydroxymethyltransferase
64% identity, 87% coverage: 18:393/432 of query aligns to 1:376/402 of 2dkjA
- active site: Y46 (= Y63), E48 (= E65), D192 (= D209), T218 (= T235), K221 (= K238), R227 (= R244)
- binding pyridoxal-5'-phosphate: S88 (= S105), G89 (= G106), S90 (= S107), H117 (= H134), S167 (= S184), D192 (= D209), A194 (= A211), H220 (= H237), K221 (= K238)
1kl2A Crystal structure of serine hydroxymethyltransferase complexed with glycine and 5-formyl tetrahydrofolate (see paper)
60% identity, 95% coverage: 14:423/432 of query aligns to 2:404/405 of 1kl2A
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: E53 (= E65), Y60 (= Y72), G121 (= G133), H122 (= H134), S172 (= S184), F251 (= F264), N341 (= N354)
- binding glycine: S31 (= S43), Y51 (= Y63), Y61 (= Y73), H200 (= H212), R357 (= R370)
- binding pyridoxal-5'-phosphate: S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), T223 (= T235), H225 (= H237), K226 (= K238)
1kl1A Crystal structure of serine hydroxymethyltransferase complexed with glycine (see paper)
60% identity, 95% coverage: 14:423/432 of query aligns to 2:404/405 of 1kl1A
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding glycine: S31 (= S43), H122 (= H134), R357 (= R370)
- binding pyridoxal-5'-phosphate: S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), A171 (≠ G183), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), T223 (= T235), H225 (= H237), K226 (= K238)
1kkpA Crystal structure of serine hydroxymethyltransferase complexed with serine (see paper)
60% identity, 95% coverage: 14:423/432 of query aligns to 2:404/405 of 1kkpA
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding pyridoxal-5'-phosphate: S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), K226 (= K238)
- binding serine: S31 (= S43), H122 (= H134), R357 (= R370)
1kkjA Crystal structure of serine hydroxymethyltransferase from b.Stearothermophilus (see paper)
60% identity, 95% coverage: 14:423/432 of query aligns to 2:404/405 of 1kkjA
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding pyridoxal-5'-phosphate: S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), T223 (= T235), H225 (= H237), K226 (= K238)
2vmyA Crystal structure of f351gbsshmt in complex with gly and fthf (see paper)
61% identity, 94% coverage: 16:423/432 of query aligns to 4:404/405 of 2vmyA
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E53 (= E65), Y60 (= Y72), Y61 (= Y73), L117 (= L129), G121 (= G133), H122 (= H134), L123 (= L135), S172 (= S184), K248 (≠ S261), F251 (= F264), N341 (= N354), S349 (≠ K362), P350 (= P363), G351 (≠ T364), R357 (= R370)
- binding glycine: S31 (= S43), Y51 (= Y63), Y61 (= Y73), H200 (= H212), K226 (= K238), R357 (= R370)
- binding pyridoxal-5'-phosphate: Y51 (= Y63), S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), T223 (= T235), K226 (= K238), G257 (= G270)
2vmxA Crystal structure of f351gbsshmt in complex with l-allo-thr (see paper)
61% identity, 94% coverage: 16:423/432 of query aligns to 4:404/405 of 2vmxA
- active site: Y51 (= Y63), E53 (= E65), D197 (= D209), T223 (= T235), K226 (= K238), R232 (= R244)
- binding allo-threonine: S31 (= S43), H122 (= H134), H200 (= H212), R357 (= R370)
- binding pyridoxal-5'-phosphate: S93 (= S105), G94 (= G106), A95 (≠ S107), H122 (= H134), S172 (= S184), D197 (= D209), A199 (= A211), H200 (= H212), T223 (= T235), K226 (= K238)
7x5oB Crystal structure of e. Faecium shmt in complex with me-thf and plp- gly (see paper)
59% identity, 95% coverage: 20:429/432 of query aligns to 7:411/412 of 7x5oB
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S30 (= S43), Y50 (= Y63), Y60 (= Y73), S92 (= S105), G93 (= G106), S94 (= S107), H121 (= H134), S171 (= S184), D196 (= D209), A198 (= A211), H199 (= H212), K225 (= K238), R358 (= R370)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E52 (= E65), Y59 (= Y72), L116 (= L129), G119 (= G132), G120 (= G133), H121 (= H134), S171 (= S184), P252 (= P265), N342 (= N354), P351 (= P363)
7x5nA Crystal structure of e. Faecium shmt in complex with (+)-shin-1 and plp-ser (see paper)
59% identity, 95% coverage: 20:428/432 of query aligns to 6:409/409 of 7x5nA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (= E65), Y58 (= Y72), Y59 (= Y73), L115 (= L129), G119 (= G133), H120 (= H134), L121 (= L135), K340 (= K353), N341 (= N354), S342 (≠ G355), P350 (= P363), F351 (≠ T364), R357 (= R370)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S29 (= S43), Y49 (= Y63), E51 (= E65), Y59 (= Y73), S91 (= S105), G92 (= G106), S93 (= S107), H120 (= H134), S170 (= S184), D195 (= D209), A197 (= A211), H198 (= H212), K224 (= K238), R357 (= R370)
7v3dA Complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor (see paper)
59% identity, 95% coverage: 20:428/432 of query aligns to 6:409/409 of 7v3dA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (= E65), Y58 (= Y72), L115 (= L129), G119 (= G133), H120 (= H134), L121 (= L135), K340 (= K353), S342 (≠ G355), P350 (= P363), F351 (≠ T364), R357 (= R370)
- binding pyridoxal-5'-phosphate: Y49 (= Y63), S91 (= S105), G92 (= G106), S93 (= S107), H120 (= H134), S170 (= S184), D195 (= D209), A197 (= A211), K224 (= K238), G255 (= G269)
4wxgA Crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-threonine and glycine (see paper)
59% identity, 95% coverage: 20:429/432 of query aligns to 6:410/410 of 4wxgA
- active site: T43 (= T57), L45 (= L59), G189 (= G203), A215 (= A229), T218 (≠ A232), R230 (= R244)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-threonine: S29 (= S43), Y49 (= Y63), E51 (= E65), Y59 (= Y73), S91 (= S105), G92 (= G106), S93 (= S107), H120 (= H134), S170 (= S184), D195 (= D209), A197 (= A211), H198 (= H212), T221 (= T235), K224 (= K238), G255 (= G269), R357 (= R370)
4wxfA Crystal structure of l-serine hydroxymethyltransferase in complex with glycine (see paper)
59% identity, 95% coverage: 20:429/432 of query aligns to 6:410/410 of 4wxfA
- active site: T43 (= T57), L45 (= L59), G189 (= G203), A215 (= A229), T218 (≠ A232), R230 (= R244)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S29 (= S43), Y49 (= Y63), Y59 (= Y73), S91 (= S105), G92 (= G106), S93 (= S107), H120 (= H134), S170 (= S184), D195 (= D209), A197 (= A211), H198 (= H212), H223 (= H237), K224 (= K238), G255 (= G269), R357 (= R370)
Query Sequence
>GFF1172 PGA1_c11870 serine hydroxymethyltransferase GlyA
MTVTTSRDPGFFTQSLAERDPELFGSITDELGRQRDEIELIASENIVSAAVMEAQGTVLT
NKYAEGYPGRRYYGGCQYVDVAENLAIDRAKKLFDCEFANVQPNSGSQANQGVFQALIKP
GDTILGMDLASGGHLTHGARPNQSGKWFNAVHYGVREEDCLIDYDQIEALAVEHQPKLII
AGGSAIPRVIDFARFREIADKVGAYLHVDMAHFAGLVAAGEHPSPFPHAHVATTTTHKTL
RGPRGGMILTNDADIAKKVNSAIFPGIQGGPLMHVIAAKAVAFGEALRPEFKDYQKQVRA
NAVALSDQLIKGGLDIVTGGTDTHVMLVDLRPKGVTGNIVDKALGRAHITTNKNGIPFDP
EKPTVTSGIRLGTPAGTTRGFGEAEFREIADLIIEVVDGLAANGEDGNATVEASVREKVA
ALCARFPLYPNH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory