SitesBLAST
Comparing GFF1174 FitnessBrowser__Phaeo:GFF1174 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
30% identity, 88% coverage: 8:427/480 of query aligns to 4:422/457 of 5h6sC
- active site: K77 (= K82), S152 (= S157), S153 (= S158), L173 (≠ I178), G174 (= G179), G175 (= G180), S176 (= S181)
- binding 4-oxidanylbenzohydrazide: C126 (≠ S131), R128 (= R133), W129 (≠ A134), S152 (= S157), L173 (≠ I178), G174 (= G179), S176 (= S181), W306 (vs. gap), F338 (= F341)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
26% identity, 90% coverage: 6:439/480 of query aligns to 2:449/478 of 3h0mA
- active site: K72 (= K82), S147 (= S157), S148 (= S158), S166 (≠ N176), T168 (≠ I178), G169 (= G179), G170 (= G180), S171 (= S181), Q174 (≠ F184)
- binding glutamine: M122 (≠ F132), G123 (≠ R133), D167 (= D177), T168 (≠ I178), G169 (= G179), G170 (= G180), S171 (= S181), F199 (≠ L215), Y302 (vs. gap), R351 (≠ D339), D418 (≠ A409)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
26% identity, 90% coverage: 6:439/480 of query aligns to 2:449/478 of 3h0lA
- active site: K72 (= K82), S147 (= S157), S148 (= S158), S166 (≠ N176), T168 (≠ I178), G169 (= G179), G170 (= G180), S171 (= S181), Q174 (≠ F184)
- binding asparagine: G123 (≠ R133), S147 (= S157), G169 (= G179), G170 (= G180), S171 (= S181), Y302 (vs. gap), R351 (≠ D339), D418 (≠ A409)
3kfuE Crystal structure of the transamidosome (see paper)
28% identity, 95% coverage: 11:466/480 of query aligns to 2:459/468 of 3kfuE
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
27% identity, 83% coverage: 54:450/480 of query aligns to 51:462/485 of 2f2aA
- active site: K79 (= K82), S154 (= S157), S155 (= S158), S173 (≠ N176), T175 (≠ I178), G176 (= G179), G177 (= G180), S178 (= S181), Q181 (≠ F184)
- binding glutamine: G130 (≠ R133), S154 (= S157), D174 (= D177), T175 (≠ I178), G176 (= G179), S178 (= S181), F206 (≠ Q217), Y309 (vs. gap), Y310 (vs. gap), R358 (≠ D339), D425 (≠ A409)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
27% identity, 83% coverage: 54:450/480 of query aligns to 51:462/485 of 2dqnA
- active site: K79 (= K82), S154 (= S157), S155 (= S158), S173 (≠ N176), T175 (≠ I178), G176 (= G179), G177 (= G180), S178 (= S181), Q181 (≠ F184)
- binding asparagine: M129 (≠ F132), G130 (≠ R133), T175 (≠ I178), G176 (= G179), S178 (= S181), Y309 (vs. gap), Y310 (vs. gap), R358 (≠ D339), D425 (≠ A409)
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
36% identity, 50% coverage: 13:253/480 of query aligns to 10:250/487 of 1m21A
- active site: K81 (= K82), S160 (= S157), S161 (= S158), T179 (≠ N176), T181 (≠ I178), D182 (≠ G179), G183 (= G180), S184 (= S181), C187 (≠ F184)
- binding : A129 (≠ S131), N130 (vs. gap), F131 (= F132), C158 (≠ G155), G159 (= G156), S160 (= S157), S184 (= S181), C187 (≠ F184), I212 (≠ Q217)
Sites not aligning to the query:
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
29% identity, 89% coverage: 7:435/480 of query aligns to 5:452/490 of 4yjiA
- active site: K79 (= K82), S158 (= S157), S159 (= S158), G179 (≠ I178), G180 (= G179), G181 (= G180), A182 (≠ S181)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (vs. gap), G132 (≠ S131), S158 (= S157), G179 (≠ I178), G180 (= G179), A182 (≠ S181)
Q9TUI8 Fatty-acid amide hydrolase 1; Anandamide amidase; Anandamide amidohydrolase 1; Fatty acid ester hydrolase; Oleamide hydrolase 1; EC 3.5.1.99; EC 3.1.1.- from Sus scrofa (Pig) (see paper)
34% identity, 63% coverage: 13:313/480 of query aligns to 81:378/579 of Q9TUI8
- S217 (= S157) mutation to A: Loss of activity.
- S218 (= S158) mutation to A: Lowers activity by at least 98%.
- D237 (= D177) mutation D->E,N: Loss of activity.
- S241 (= S181) mutation to A: Loss of activity.
- C249 (≠ N189) mutation to A: Loss of activity.
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 86% coverage: 51:462/480 of query aligns to 174:589/607 of Q7XJJ7
- K205 (= K82) mutation to A: Loss of activity.
- SS 281:282 (= SS 157:158) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ IGGS 178:181) binding
- S305 (= S181) mutation to A: Loss of activity.
- R307 (= R183) mutation to A: Loss of activity.
- S360 (≠ P242) mutation to A: No effect.
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
24% identity, 86% coverage: 51:462/480 of query aligns to 174:589/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ S131), T258 (≠ A134), S281 (= S157), G302 (≠ I178), G303 (= G179), S305 (= S181), S472 (≠ I340), I532 (≠ V402), M539 (≠ A409)
Sites not aligning to the query:
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
29% identity, 95% coverage: 5:461/480 of query aligns to 2:468/482 of 3a2qA
- active site: K69 (= K82), S147 (= S157), S148 (= S158), N166 (= N176), A168 (≠ I178), A169 (≠ G179), G170 (= G180), A171 (≠ S181), I174 (≠ F184)
- binding 6-aminohexanoic acid: G121 (≠ S131), G121 (≠ S131), N122 (≠ F132), S147 (= S157), A168 (≠ I178), A168 (≠ I178), A169 (≠ G179), A171 (≠ S181), C313 (≠ P304)
2vyaA Crystal structure of fatty acid amide hydrolase conjugated with the drug-like inhibitor pf-750 (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 52:326/543 of 2vyaA
- active site: K110 (= K82), S185 (= S157), S186 (= S158), T204 (≠ N176), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), F212 (= F184)
- binding 4-(quinolin-3-ylmethyl)piperidine-1-carboxylic acid: F160 (= F132), S161 (≠ R133), I206 (= I178), G207 (= G179), S209 (= S181)
Sites not aligning to the query:
4j5pA Crystal structure of a covalently bound alpha-ketoheterocycle inhibitor (phenhexyl/oxadiazole/pyridine) to a humanized variant of fatty acid amide hydrolase (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 52:326/544 of 4j5pA
- active site: K110 (= K82), S185 (= S157), S186 (= S158), T204 (≠ N176), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), F212 (= F184)
- binding (1S)-1-{5-[5-(bromomethyl)pyridin-2-yl]-1,3-oxazol-2-yl}-7-phenylheptan-1-ol: S158 (≠ F130), M159 (≠ S131), F160 (= F132), S161 (≠ R133), S185 (= S157), T204 (≠ N176), D205 (= D177), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), C237 (≠ I214)
Sites not aligning to the query:
2wj1A 3d-crystal structure of humanized-rat fatty acid amide hydrolase (faah) conjugated with 7-phenyl-1-(4-(pyridin-2-yl)oxazol-2-yl) heptan- 1-one, an alpha-ketooxazole (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 51:325/543 of 2wj1A
- active site: K109 (= K82), S184 (= S157), S185 (= S158), T203 (≠ N176), I205 (= I178), G206 (= G179), G207 (= G180), S208 (= S181), F211 (= F184)
- binding 7-phenyl-1-(4-pyridin-2-yl-1,3-oxazol-2-yl)heptane-1,1-diol: S157 (≠ F130), M158 (≠ S131), F159 (= F132), S184 (= S157), T203 (≠ N176), D204 (= D177), I205 (= I178), G206 (= G179), S208 (= S181), C236 (≠ I214)
Sites not aligning to the query:
6mrgA Faah bound to non covalent inhibitor (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 53:327/543 of 6mrgA
Sites not aligning to the query:
- active site: 48, 427, 453, 458, 459
- binding (1R)-2-{[6-(2,3-dihydro-1,4-benzodioxin-6-yl)pyrimidin-4-yl]amino}-1-phenylethan-1-ol: 373, 376, 401, 457, 464, 500
3ppmA Crystal structure of a noncovalently bound alpha-ketoheterocycle inhibitor (phenhexyl/oxadiazole/pyridine) to a humanized variant of fatty acid amide hydrolase (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 52:326/546 of 3ppmA
- active site: K110 (= K82), S185 (= S157), S186 (= S158), T204 (≠ N176), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), F212 (= F184)
- binding fluoride ion: D205 (= D177), I206 (= I178), G207 (= G179), S209 (= S181)
- binding 7-phenyl-1-[5-(pyridin-2-yl)-1,3,4-oxadiazol-2-yl]heptan-1-one: M159 (≠ S131), F160 (= F132), S185 (= S157), T204 (≠ N176), I206 (= I178), S209 (= S181), G236 (= G213), L246 (≠ G223)
Sites not aligning to the query:
3k84A Crystal structure analysis of a oleyl/oxadiazole/pyridine inhibitor bound to a humanized variant of fatty acid amide hydrolase (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 52:326/546 of 3k84A
- active site: K110 (= K82), S185 (= S157), S186 (= S158), T204 (≠ N176), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), F212 (= F184)
- binding (9Z)-1-(5-pyridin-2-yl-1,3,4-oxadiazol-2-yl)octadec-9-en-1-one: M159 (≠ S131), F160 (= F132), S161 (≠ R133), S185 (= S157), T204 (≠ N176), I206 (= I178), G207 (= G179), S209 (= S181)
Sites not aligning to the query:
3k83A Crystal structure analysis of a biphenyl/oxazole/carboxypyridine alpha-ketoheterocycle inhibitor bound to a humanized variant of fatty acid amide hydrolase (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 52:326/546 of 3k83A
- active site: K110 (= K82), S185 (= S157), S186 (= S158), T204 (≠ N176), I206 (= I178), G207 (= G179), G208 (= G180), S209 (= S181), F212 (= F184)
- binding 6-[2-(3-biphenyl-4-ylpropanoyl)-1,3-oxazol-5-yl]pyridine-2-carboxylic acid: M159 (≠ S131), F160 (= F132), S161 (≠ R133), S185 (= S157), D205 (= D177), I206 (= I178), G207 (= G179), S209 (= S181), G236 (= G213), C237 (≠ I214), V238 (≠ L215), L246 (≠ G223)
Sites not aligning to the query:
3k7fA Crystal structure analysis of a phenhexyl/oxazole/carboxypyridine alpha-ketoheterocycle inhibitor bound to a humanized variant of fatty acid amide hydrolase' (see paper)
34% identity, 59% coverage: 16:296/480 of query aligns to 53:327/543 of 3k7fA
- active site: K111 (= K82), S186 (= S157), S187 (= S158), T205 (≠ N176), I207 (= I178), G208 (= G179), G209 (= G180), S210 (= S181), F213 (= F184)
- binding 6-[2-(7-phenylheptanoyl)-1,3-oxazol-5-yl]pyridine-2-carboxylic acid: M160 (≠ S131), F161 (= F132), S162 (≠ R133), S186 (= S157), D206 (= D177), I207 (= I178), G208 (= G179), S210 (= S181), G237 (= G213), C238 (≠ I214), V239 (≠ L215)
Sites not aligning to the query:
Query Sequence
>GFF1174 FitnessBrowser__Phaeo:GFF1174
MTQSDIWRLSATELSRRTTAGDLTAEAAVAASLTRMTAVNPDLNAVVEDLSSEALGRAQQ
LDKARASGAPCGPLHGVPVTIKINVDQAGHATSNGVSALKDLIAADDAPVVKNLQDAGAV
VIGRTNTPEFSFRADTDNPLHGRTHNPWGRHISPGGSSGGAGAAVMAGIGALAHGNDIGG
SLRFPAAANGAVTVKPGLGRVPAWNPSQSAERGILAQNMSVQGLLTRTAQDLHLSMPSLI
APDPRDPFHVPLPWHGASPDGPIRVAFSKETYGYDLHPEVDAALEDARAALSDAGYLVEE
TVLPDVFDAGRTGYRALMGEVYALMKGDVDAAGSQTVRDIFAVYFEEFPPFAGVELLQMM
AKRTQYARDWSLFMQRYPLVLTPFLPQPFFRPDRDTEGAAGVHEVLGCAVYSYAMNFLGL
PAASVPSRLAELPSGPQPINVQIAAPRWREDMAVDACLAIEDRIGRMCDQLWQRMSIANG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory