SitesBLAST
Comparing GFF1178 FitnessBrowser__psRCH2:GFF1178 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
45% identity, 95% coverage: 2:461/482 of query aligns to 3:430/450 of 2w54A
- binding flavin-adenine dinucleotide: G42 (= G42), L189 (= L218), A191 (= A220), G192 (= G221), G193 (= G222), T194 (= T223), D195 (= D224), V196 (≠ L225), W199 (≠ D228), L213 (≠ V242), F258 (= F287), A259 (= A288), A267 (≠ G296), T268 (= T297), G271 (= G300), N272 (= N301), A274 (≠ G303), N275 (= N304), G280 (= G309), D281 (= D310), R318 (= R347), V324 (≠ I353), Q347 (≠ D378)
- binding fe2/s2 (inorganic) cluster: G38 (= G38), C39 (= C39), N40 (≠ A40), G42 (= G42), C44 (= C44), G45 (= G45), C47 (= C47), C63 (= C67), C103 (= C106), G104 (= G107), C106 (= C109), C134 (= C144), R135 (= R145), C136 (= C146)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: Q102 (= Q105), C136 (= C146)
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
45% identity, 95% coverage: 2:461/482 of query aligns to 3:430/450 of 1jroA
- binding flavin-adenine dinucleotide: G42 (= G42), D43 (= D43), L189 (= L218), A191 (= A220), G192 (= G221), G193 (= G222), T194 (= T223), D195 (= D224), V196 (≠ L225), F258 (= F287), A259 (= A288), T268 (= T297), G271 (= G300), N272 (= N301), A274 (≠ G303), G280 (= G309), D281 (= D310), R318 (= R347), V324 (≠ I353)
- binding fe2/s2 (inorganic) cluster: E37 (= E37), G38 (= G38), C39 (= C39), N40 (≠ A40), G42 (= G42), C44 (= C44), G45 (= G45), C47 (= C47), C63 (= C67), C103 (= C106), C106 (= C109), C134 (= C144), C136 (= C146)
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
30% identity, 96% coverage: 4:467/482 of query aligns to 6:491/1286 of 4yswA
- binding flavin-adenine dinucleotide: G44 (= G42), K226 (≠ R217), L227 (= L218), V228 (≠ L219), V229 (≠ A220), G230 (= G221), N231 (≠ G222), T232 (= T223), E233 (≠ D224), I234 (≠ L225), F307 (= F287), A308 (= A288), V312 (≠ I292), A316 (≠ G296), S317 (≠ T297), G320 (= G300), N321 (= N301), I323 (≠ G303), T324 (≠ N304), S329 (≠ G309), D330 (= D310), I373 (≠ F352), L374 (≠ I353), D399 (= D378)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), C110 (= C106), G111 (= G107), C113 (= C109), C145 (= C144), C147 (= C146)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E233 (≠ D224), S326 (= S306), P327 (= P307), I328 (= I308), Y363 (= Y342), R364 (≠ K343), D400 (= D379), I401 (= I380), G428 (= G405), A430 (= A407), D431 (≠ A408), P471 (≠ R448), R478 (= R454)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding fe2/s2 (inorganic) cluster: 715
- binding 1,4-dihydronicotinamide adenine dinucleotide: 1196
- binding uric acid: 773, 851, 885, 980, 981, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
30% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1291 of 2e3tA
- binding flavin-adenine dinucleotide: G44 (= G42), K228 (≠ R217), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), L309 (≠ F287), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), S331 (≠ G309), D332 (= D310), I375 (≠ F352), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), N69 (= N65), C71 (= C67), Q109 (= Q105), C110 (= C106), C113 (= C109), C145 (= C144), C147 (= C146)
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 882, 883, 887, 888, 891
- binding calcium ion: 713, 714, 716, 809, 810, 840, 843, 844, 847, 880, 881
- binding fe2/s2 (inorganic) cluster: 717
- binding uric acid: 775, 853, 887, 982, 983, 1051, 1052, 1234
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
30% identity, 96% coverage: 4:467/482 of query aligns to 6:491/1291 of 6a7xB
- binding flavin-adenine dinucleotide: G44 (= G42), L227 (= L218), V228 (≠ L219), V229 (≠ A220), G230 (= G221), N231 (≠ G222), T232 (= T223), E233 (≠ D224), I234 (≠ L225), F307 (= F287), V312 (≠ I292), S317 (≠ T297), G320 (= G300), N321 (= N301), I323 (≠ G303), T324 (≠ N304), D330 (= D310), I373 (≠ F352), L374 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), N69 (= N65), C71 (= C67), Q109 (= Q105), C110 (= C106), G111 (= G107), C113 (= C109), C145 (= C144), C147 (= C146)
- binding nicotinamide-adenine-dinucleotide: P327 (= P307), Y363 (= Y342), R364 (≠ K343), G428 (= G405), A430 (= A407), D431 (≠ A408), P471 (≠ R448), R478 (= R454)
Sites not aligning to the query:
- active site: 738, 773, 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 810, 811, 880, 881, 885, 886, 889
- binding fe2/s2 (inorganic) cluster: 715
- binding uric acid: 773, 851, 885, 980, 981, 1049, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
30% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1295 of 6a7xA
- binding flavin-adenine dinucleotide: G44 (= G42), K228 (≠ R217), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), V314 (≠ I292), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), D332 (= D310), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), N69 (= N65), C71 (= C67), Q109 (= Q105), C110 (= C106), G111 (= G107), C113 (= C109), C145 (= C144), C147 (= C146)
- binding nicotinamide-adenine-dinucleotide: P329 (= P307), Y365 (= Y342), R366 (≠ K343), A432 (= A407), D433 (≠ A408), P473 (≠ R448), R480 (= R454)
Sites not aligning to the query:
- active site: 740, 775, 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 812, 813, 850, 883, 884, 887, 888, 891
- binding uric acid: 775, 853, 887, 982, 983, 1052, 1234
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1290 of 1n5xA
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), L229 (= L218), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A310 (= A288), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), D332 (= D310), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding fe2/s2 (inorganic) cluster: 711
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 615, 738, 769, 840, 847, 881, 976, 977, 978, 981
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1293 of 3am9A
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), K228 (≠ R217), L229 (= L218), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A310 (= A288), V314 (≠ I292), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), D332 (= D310), L376 (≠ I353), K394 (= K371)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding bicarbonate ion: 805, 806, 875, 876, 877, 884
- binding calcium ion: 707, 709, 802, 803, 833, 836, 837, 840, 873, 874
- binding fe2/s2 (inorganic) cluster: 710
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: 614, 768, 839, 842, 846, 880, 975, 980, 1045, 1227
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1298 of 1v97A
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), K228 (≠ R217), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A310 (= A288), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), S331 (≠ G309), D332 (= D310), I375 (≠ F352), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding calcium ion: 833, 836, 837, 840, 873, 874
- binding fe2/s2 (inorganic) cluster: 710
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 768, 839, 846, 880, 975, 980, 1042, 1044, 1045, 1227
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1299 of 1vdvA
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A310 (= A288), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), S331 (≠ G309), D332 (= D310), I375 (≠ F352), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding calcium ion: 708, 710, 803, 804, 834, 837, 838, 841, 874, 875
- binding fe2/s2 (inorganic) cluster: 711
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: 769, 840, 843, 847, 881, 976, 977, 978, 981, 1043, 1046
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1299 of 1fo4A
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), K228 (≠ R217), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A310 (= A288), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), S331 (≠ G309), D332 (= D310), I375 (≠ F352), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), R147 (= R145), C148 (= C146)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding calcium ion: 834, 837, 838, 841, 874, 875
- binding fe2/s2 (inorganic) cluster: 711
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 96% coverage: 4:467/482 of query aligns to 8:520/1331 of P22985
- C43 (= C39) binding
- C48 (= C44) binding
- C51 (= C47) binding
- C73 (= C67) binding
- C112 (= C106) binding
- C115 (= C109) binding
- C147 (= C144) binding
- C149 (= C146) binding
- 256:263 (vs. 218:225, 38% identical) binding
- WF 335:336 (≠ RF 286:287) mutation to AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- SIGGN 346:350 (≠ TLGGN 297:301) binding
- D359 (= D310) binding
- L403 (≠ I353) binding
Sites not aligning to the query:
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:493/1291 of 3amzA
- binding flavin-adenine dinucleotide: G44 (= G42), L229 (= L218), V230 (≠ L219), V231 (≠ A220), G232 (= G221), N233 (≠ G222), T234 (= T223), E235 (≠ D224), I236 (≠ L225), F309 (= F287), A318 (≠ G296), S319 (≠ T297), G322 (= G300), N323 (= N301), I325 (≠ G303), T326 (≠ N304), S331 (≠ G309), D332 (= D310), I375 (≠ F352), L376 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S328 (= S306), P329 (= P307), I330 (= I308), Y365 (= Y342), R366 (≠ K343), D402 (= D379), I403 (= I380), G430 (= G405), A432 (= A407), D433 (≠ A408), P473 (≠ R448), R480 (= R454)
Sites not aligning to the query:
- active site: 731, 766, 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 803, 804, 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding fe2/s2 (inorganic) cluster: 708
- binding 1,4-dihydronicotinamide adenine dinucleotide: 1189
- binding uric acid: 766, 844, 878, 973, 974, 1043, 1225
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
31% identity, 91% coverage: 4:441/482 of query aligns to 6:468/1307 of 2e1qA
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), K230 (≠ R217), L231 (= L218), V232 (≠ L219), V233 (≠ A220), G234 (= G221), N235 (≠ G222), T236 (= T223), E237 (≠ D224), I238 (≠ L225), F311 (= F287), A312 (= A288), V316 (≠ I292), A320 (≠ G296), S321 (≠ T297), G324 (= G300), N325 (= N301), I327 (≠ G303), T328 (≠ N304), S333 (≠ G309), D334 (= D310), I377 (≠ F352), L378 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding fe2/s2 (inorganic) cluster: 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:491/1286 of 3unaA
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), L227 (= L218), V228 (≠ L219), V229 (≠ A220), G230 (= G221), N231 (≠ G222), T232 (= T223), E233 (≠ D224), I234 (≠ L225), F307 (= F287), A308 (= A288), A316 (≠ G296), S317 (≠ T297), G320 (= G300), N321 (= N301), I323 (≠ G303), T324 (≠ N304), S329 (≠ G309), D330 (= D310), I373 (≠ F352), L374 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), N69 (= N65), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
- binding nicotinamide-adenine-dinucleotide: P327 (= P307), Y363 (= Y342), R364 (≠ K343), A430 (= A407), D431 (≠ A408), P471 (≠ R448), R478 (= R454)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding fe2/s2 (inorganic) cluster: 706
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 6:491/1286 of 3bdjA
- binding flavin-adenine dinucleotide: E43 (≠ S41), G44 (= G42), L227 (= L218), V228 (≠ L219), V229 (≠ A220), G230 (= G221), N231 (≠ G222), T232 (= T223), E233 (≠ D224), I234 (≠ L225), F307 (= F287), A308 (= A288), A316 (≠ G296), S317 (≠ T297), G320 (= G300), N321 (= N301), I323 (≠ G303), T324 (≠ N304), S329 (≠ G309), D330 (= D310), I373 (≠ F352), L374 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G40 (= G38), C41 (= C39), G42 (≠ A40), G44 (= G42), C46 (= C44), G47 (= G45), C49 (= C47), N69 (= N65), C71 (= C67), Q110 (= Q105), C111 (= C106), G112 (= G107), C114 (= C109), C146 (= C144), C148 (= C146)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding Oxypurinol: 764, 842, 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding fe2/s2 (inorganic) cluster: 706
- binding Oxo(sulfanyl)molybdenum(IV) ION: 761, 872, 873, 874, 1223
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
31% identity, 96% coverage: 4:467/482 of query aligns to 7:462/1225 of 3ax7A
- binding flavin-adenine dinucleotide: G45 (= G42), K197 (≠ R217), L198 (= L218), V199 (≠ L219), V200 (≠ A220), G201 (= G221), N202 (≠ G222), T203 (= T223), E204 (≠ D224), I205 (≠ L225), F278 (= F287), A279 (= A288), V283 (≠ I292), A287 (≠ G296), S288 (≠ T297), G291 (= G300), N292 (= N301), I294 (≠ G303), T295 (≠ N304), S300 (≠ G309), D301 (= D310), L345 (≠ I353)
- binding fe2/s2 (inorganic) cluster: G41 (= G38), C42 (= C39), G43 (≠ A40), G45 (= G42), C47 (= C44), G48 (= G45), C50 (= C47), N70 (= N65), C72 (= C67), C112 (= C106), G113 (= G107), C115 (= C109), C147 (= C144), C149 (= C146)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: Q111 (= Q105), C149 (= C146)
Sites not aligning to the query:
- active site: 666, 701, 779, 783, 811, 1159, 1160
- binding bicarbonate ion: 738, 739, 776, 808, 809, 814, 817
- binding calcium ion: 766, 769, 770, 773, 806, 807
- binding fe2/s2 (inorganic) cluster: 643
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 695, 696, 697, 698, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
30% identity, 91% coverage: 4:441/482 of query aligns to 8:494/1333 of P47989
- E133 (= E129) to K: in dbSNP:rs45447191
- G172 (vs. gap) to R: in dbSNP:rs45523133
- T235 (vs. gap) to M: in dbSNP:rs45469499
- 257:264 (vs. 218:225, 38% identical) binding
- F337 (= F287) binding
- SVGGN 347:351 (≠ TLGGN 297:301) binding
- D360 (= D310) binding
- K395 (≠ V344) to M: in dbSNP:rs34929837
- K422 (= K371) binding
Sites not aligning to the query:
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
P80457 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Bos taurus (Bovine) (see 5 papers)
29% identity, 96% coverage: 4:467/482 of query aligns to 8:521/1332 of P80457
- C43 (= C39) binding
- C48 (= C44) binding
- C51 (= C47) binding
- C73 (= C67) binding
- C113 (= C106) binding
- C116 (= C109) binding
- C148 (= C144) binding
- C150 (= C146) binding
- 257:264 (vs. 218:225, 38% identical) binding
- R335 (≠ Q285) mutation to A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- W336 (≠ R286) mutation to A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- F337 (= F287) binding
- SLGGN 347:351 (≠ TLGGN 297:301) binding
- D360 (= D310) binding
- L404 (≠ I353) binding
- K422 (= K371) binding
- R427 (≠ L376) mutation to Q: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 767 binding
- 798 binding
- 912 binding
- 1079 binding
- 1261 active site, Proton acceptor
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 93% coverage: 19:467/482 of query aligns to 34:551/1361 of Q8GUQ8
- W364 (≠ R286) mutation to A: Decreases activity 8-fold.
- Y421 (= Y342) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
Query Sequence
>GFF1178 FitnessBrowser__psRCH2:GFF1178
MIQFLLNRELRSERALDPNTTVLQYLREHRGKTGTKEGCASGDCGACTVVVGELVDDRLR
YRTLNSCLTFVSALHGKQLISVEDLKDQGRLHSVQQAMVDCHGSQCGFCTPGFVMSLFAL
QKNAGAVNEYDPHQTHEALAGNLCRCTGYRPILEAAEQACCGKQPDQFDAREAETIAQLK
AIEPRETAELNSGDKRCLSPLTVDDLADIYSANPDARLLAGGTDLALDVTQFHRELPVMI
YVGHIAEMKKVEITDSSIEIGAAAPLTDCYAALAAEYPDFGELLQRFASLQIRNQGTLGG
NIGNASPIGDSPPLLIALGAEVVLRHGASSRALPLEDYFIDYKVTARQPGEFIEKIIVPR
ATSDRLFRAYKVSKRLDDDISAVCAAFDLQITDGVVADARVAFGGMAAIPKRAAACEATL
NGAPWNQQTVEAACEALAEDFTPLTDFRASREYRLLVAQNLLRKCFLEQHAPKTETRVTA
YV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory