Comparing GFF1182 FitnessBrowser__Marino:GFF1182 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
66% identity, 95% coverage: 19:378/378 of query aligns to 16:376/377 of 7t1qA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
60% identity, 99% coverage: 4:378/378 of query aligns to 1:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
60% identity, 99% coverage: 4:377/378 of query aligns to 1:375/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
61% identity, 98% coverage: 7:378/378 of query aligns to 6:377/377 of 7lgpB
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
58% identity, 98% coverage: 9:377/378 of query aligns to 10:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
58% identity, 98% coverage: 9:377/378 of query aligns to 6:375/377 of P44514
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
65% identity, 49% coverage: 4:190/378 of query aligns to 1:185/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
62% identity, 46% coverage: 9:183/378 of query aligns to 8:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 97% coverage: 14:378/378 of query aligns to 16:383/383 of 7uoiA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
28% identity, 49% coverage: 15:200/378 of query aligns to 28:224/426 of 3pfoA
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
27% identity, 67% coverage: 7:260/378 of query aligns to 4:261/380 of 7rsfA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 81% coverage: 69:376/378 of query aligns to 79:398/408 of Q03154
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 81% coverage: 70:376/378 of query aligns to 80:397/407 of P37111
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
28% identity, 40% coverage: 52:201/378 of query aligns to 105:262/503 of Q8C165
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
21% identity, 72% coverage: 54:327/378 of query aligns to 81:417/475 of Q96KP4
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 26% coverage: 61:159/378 of query aligns to 82:176/458 of 2pokA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
21% identity, 70% coverage: 65:327/378 of query aligns to 94:417/475 of Q9D1A2
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
21% identity, 70% coverage: 65:327/378 of query aligns to 98:421/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
21% identity, 70% coverage: 65:327/378 of query aligns to 98:421/478 of 2zofA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
29% identity, 34% coverage: 65:191/378 of query aligns to 127:253/507 of Q96KN2
Sites not aligning to the query:
>GFF1182 FitnessBrowser__Marino:GFF1182
MQTTDSPTLELAVDLIRRPSVTPDDAGCQELMMSRLAPLGFTGENLRFGDTDNLWARKGS
EGPVLAFAGHTDVVPTGPEKNWSHPPFDPVIRDGYLLGRGAADMKGSLAAFVTACERFVA
SYPDHRGSIALLITSDEEGPAQHGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNG
RRGSLHGYLTVHGVQGHVAYPHLAENPVHLVAPALDALAKEFWDNGNDFFPPTTFQITKL
EAGTGSNIIPGECLVHFNFRYCTENTAESLEERVVAILDRHNLKYDLQWHLSGRPFLTDK
GALVSASQSAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDECVKAD
DLNTLSEIYEQILIELLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory