SitesBLAST
Comparing GFF1187 FitnessBrowser__Phaeo:GFF1187 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
43% identity, 97% coverage: 1:711/733 of query aligns to 9:726/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
43% identity, 97% coverage: 1:711/733 of query aligns to 9:726/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (= V27), N39 (= N29), G75 (= G64), D77 (= D66), M81 (≠ L70), V92 (≠ L85), T95 (≠ G88), P148 (= P150), E149 (= E151), L152 (≠ V154), Q180 (≠ E181), Q260 (≠ K254), K362 (≠ I355), D363 (= D356), V364 (≠ R357), V430 (≠ M423), D476 (≠ E469), K477 (= K470), M478 (= M471), P479 (≠ F472), K506 (= K499)
- binding formamide: V78 (≠ L67), K79 (≠ N68)
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
43% identity, 97% coverage: 1:711/733 of query aligns to 8:725/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ G30), G74 (= G64), M80 (≠ L70), V91 (≠ L85), T94 (≠ G88), T94 (≠ G88), E148 (= E151), L151 (≠ V154), R182 (≠ L184), S448 (= S442), S519 (≠ N513), R520 (= R514), L562 (≠ T556), L566 (= L560), I570 (= I564)
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G64), G77 (≠ M65), T81 (≠ V69), M82 (≠ L70), M82 (≠ L70), A85 (≠ M73), D89 (= D76), T96 (≠ G88), L123 (≠ V124), G124 (= G125), P149 (= P150), E150 (= E151), S366 (≠ D358), L367 (≠ Q359), E368 (≠ A360), A420 (= A412), V421 (= V413), F422 (= F414)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
43% identity, 97% coverage: 1:711/733 of query aligns to 12:729/731 of 4b3iA
- active site: G79 (≠ M65), E100 (≠ M90), R104 (≠ E94), G127 (≠ I126), E130 (= E129), P151 (= P150), E152 (= E151), G160 (= G159), S452 (= S442), H473 (= H463), E485 (= E475), S523 (≠ N513)
- binding adenosine-5'-diphosphate: Q640 (= Q628), P641 (= P629), P642 (≠ D630), L643 (= L631), Q644 (≠ I632)
- binding coenzyme a: T38 (≠ M25), V40 (= V27), A77 (≠ G63), G79 (≠ M65), D80 (= D66), V81 (≠ L67), E152 (= E151), F315 (= F305), Q319 (≠ E309)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G64), F169 (≠ M170), N173 (≠ A174), S177 (≠ P177), I193 (≠ A193), F313 (= F305)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L28), N40 (= N29), E41 (≠ G30), T81 (≠ V69), D92 (= D79), V93 (≠ L85)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L28), G77 (≠ M65), D78 (= D66), M82 (≠ L70), V93 (≠ L85)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ M153), R184 (≠ L184), A311 (≠ S303), F312 (≠ L304), I673 (≠ V663)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
43% identity, 97% coverage: 1:711/733 of query aligns to 11:728/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L28), N41 (= N29), E42 (≠ G30), G77 (= G64), G78 (≠ M65), D79 (= D66), V80 (≠ L67), D90 (= D76), V94 (≠ L85), L124 (≠ V124), G125 (= G125), P150 (= P150), E151 (= E151)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ G30), G76 (= G64), G77 (≠ M65), D78 (= D66), V79 (≠ L67), M82 (≠ L70), D89 (= D76), V93 (≠ L85), T96 (≠ G88), T96 (≠ G88), P149 (= P150), E150 (= E151)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L28), M82 (≠ L70), E150 (= E151), Q172 (≠ M173), F175 (vs. gap), V176 (≠ A176), Q181 (≠ E181), T241 (≠ A234), F254 (≠ A247), N257 (≠ M250), Q261 (≠ K254), L262 (≠ T255), P266 (vs. gap), P268 (= P260), Q282 (≠ L274), V283 (= V275), G302 (≠ N294), Q303 (≠ P295), V304 (≠ S296), S521 (≠ N513), G525 (≠ I517)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/729 of 8opvA
- binding resveratrol: M39 (≠ L28), A75 (≠ G63), G76 (= G64), M82 (≠ L70), E128 (= E129), P149 (= P150), E150 (= E151), T152 (≠ M153), L153 (≠ V154), R184 (≠ L184), F296 (= F288)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
43% identity, 97% coverage: 1:711/733 of query aligns to 10:727/729 of 8opuA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
43% identity, 97% coverage: 1:711/733 of query aligns to 16:733/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M16 (= M1), P17 (≠ S2), M45 (≠ L28), I50 (≠ M33), G82 (= G64), G83 (≠ M65), D84 (= D66), T87 (≠ V69), T87 (≠ V69), M88 (≠ L70), M88 (≠ L70), A91 (≠ M73), D95 (= D76), D98 (= D79), V99 (≠ L85), T102 (≠ G88), T102 (≠ G88), E134 (= E129), E156 (= E151), L159 (≠ V154), F302 (= F288), F302 (= F288), F319 (= F305), S456 (= S442), T457 (= T443), M485 (= M471), P486 (≠ F472), G523 (≠ F509), S527 (≠ N513), N535 (= N521), P560 (= P546), M575 (≠ G561), I578 (= I564), I578 (= I564), I682 (= I666), M683 (≠ L667), G686 (= G670)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
43% identity, 96% coverage: 8:711/733 of query aligns to 13:721/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
43% identity, 96% coverage: 8:711/733 of query aligns to 13:721/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ K23), S29 (≠ T24), A63 (≠ G57), K64 (= K58), K64 (= K58), K65 (= K59), P143 (= P150), E144 (= E151), L147 (≠ V154), F307 (= F305), M473 (= M471), P548 (= P546), S599 (≠ L594), L602 (≠ K597), K603 (≠ S598), S661 (≠ D657), T662 (≠ I658), G674 (= G670), A698 (= A690), R705 (≠ D695)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
43% identity, 96% coverage: 8:711/733 of query aligns to 8:709/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 98% coverage: 2:722/733 of query aligns to 2:703/707 of 6yswA
- active site: A66 (≠ M65), I71 (≠ L70), A84 (≠ E100), Q88 (≠ M104), G112 (≠ I126), E115 (= E129), P136 (= P150), E137 (= E151), G145 (= G159), D264 (≠ K282), S422 (= S442), H443 (= H463), E455 (= E475), N493 (= N513)
- binding coenzyme a: E23 (≠ K23), M25 (= M25), A66 (≠ M65), D67 (= D66), I68 (≠ L67), P136 (= P150), E137 (= E151), L140 (≠ V154), T290 (≠ E309), K293 (≠ E312)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 97% coverage: 13:722/733 of query aligns to 49:762/763 of P40939
- V282 (vs. gap) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L266) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L304) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E475) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
34% identity, 97% coverage: 11:723/733 of query aligns to 8:692/692 of 6iunB
- active site: A60 (≠ M65), F65 (≠ L70), E73 (= E80), H77 (= H93), G101 (≠ I126), E104 (= E129), E124 (= E151), G132 (= G159), K248 (= K282), S407 (= S442), H428 (= H463), E440 (= E475), N478 (= N513)
- binding nicotinamide-adenine-dinucleotide: G300 (= G335), T301 (≠ M336), M302 (= M337), E321 (≠ D356), T322 (≠ R357), Y365 (≠ L400), A377 (= A412), V378 (= V413), E380 (= E415), V384 (= V419), V388 (≠ M423), N405 (= N440), S407 (= S442)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
34% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of 1wdlA
- active site: A69 (≠ M65), N89 (≠ I89), N93 (≠ H93), G117 (≠ I126), E120 (= E129), P139 (= P150), E140 (= E151), P147 (= P158), G148 (= G159), S430 (= S442), H451 (= H463), E463 (= E475), N501 (= N513)
- binding nicotinamide-adenine-dinucleotide: A322 (= A334), I324 (≠ M336), M325 (= M337), D344 (= D356), I345 (≠ R357), A400 (= A412), V401 (= V413), E403 (= E415), N428 (= N440), T429 (= T441), S430 (= S442)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
34% identity, 97% coverage: 12:723/733 of query aligns to 16:715/715 of P28793
Query Sequence
>GFF1187 FitnessBrowser__Phaeo:GFF1187
MSDFTMKKDADGVAIITWDCPGKTMNVLNGQAMIDLDGLVDDALADDAVKGIVITSGKKD
FAGGMDLNVLAKMKEDAGDEPARGLFEGIMKMHEGLRKIERAGMDPKTNKGGKPVAAALP
GTAVGIGLELPLSTHRIFAADNPKAKIGLPEIMVGIFPGAGGTTRLVRKMGAMAAAPFLL
EGKLVDPKKAKGAGIIDEVVEDPLAAARAWVLEAKDADIVKPWDAKGYKMPGGAPYHPAG
FMTFLGAAAMVHGKTFGAFPAAKALLSAVYEGALVPFDTALKIEARWFTHVLMNPSSEAM
IRSLFLNKEALEKGAVRPAGIEDQSVKKIGVLGAGMMGAGIALVSAQAGMEVVLIDRDQA
AADKGKAYTESYLDKGIKRGKVTADKKEAMLSRITATPDLDHLKGCDLIIEAVFEDPGVK
AEMTKKVEAIIPEDCIFASNTSTLPITDLAEASVRPEQFIGIHFFSPVEKMFLVEIIKGE
KTGDRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYVNEGARMITEGVAPALIDNAA
RQLGFPVGPIQLTDETSIDLGAKIARATKAAMGDAYPESAADDLIFWMEEQGRLGRKSNA
GFFDYDDKGKRQGYWKGMQEKYPLADEQPDLIEVQERLMFAQVLEAVRALEEGVLMDIRE
GDVGAILAWGFAPWSGGPLSWLDIIGTPYAAERCDQLTAKYGERFTCPPLLREMAEKGQT
FYGRFNPEASKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory