Comparing GFF1215 FitnessBrowser__Marino:GFF1215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
62% identity, 98% coverage: 3:212/215 of query aligns to 1:210/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
36% identity, 96% coverage: 5:211/215 of query aligns to 2:208/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
39% identity, 96% coverage: 6:211/215 of query aligns to 2:201/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
39% identity, 95% coverage: 7:210/215 of query aligns to 1:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
33% identity, 95% coverage: 6:210/215 of query aligns to 3:200/202 of 7l0bA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
30% identity, 91% coverage: 13:207/215 of query aligns to 15:210/336 of 3r2uB
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
28% identity, 91% coverage: 13:207/215 of query aligns to 13:222/348 of 3r2uA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
29% identity, 91% coverage: 13:208/215 of query aligns to 10:194/350 of 5ve5A
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
30% identity, 88% coverage: 19:208/215 of query aligns to 19:212/473 of 3tp9A
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
30% identity, 88% coverage: 19:208/215 of query aligns to 23:197/237 of 4chlB
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
30% identity, 90% coverage: 19:211/215 of query aligns to 39:216/254 of O95571
Sites not aligning to the query:
6sg9FL uS3m (see paper)
25% identity, 91% coverage: 13:207/215 of query aligns to 62:294/320 of 6sg9FL
Sites not aligning to the query:
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
31% identity, 88% coverage: 19:207/215 of query aligns to 23:234/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
31% identity, 88% coverage: 19:207/215 of query aligns to 23:234/294 of 4yskA
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
32% identity, 91% coverage: 5:200/215 of query aligns to 13:206/283 of 2p18A
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
36% identity, 68% coverage: 16:162/215 of query aligns to 12:142/259 of 8ewoA
Sites not aligning to the query:
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
27% identity, 90% coverage: 19:211/215 of query aligns to 17:191/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 88% coverage: 26:214/215 of query aligns to 77:256/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
28% identity, 88% coverage: 26:214/215 of query aligns to 28:207/244 of 2gcuA
Q68D91 Acyl-coenzyme A thioesterase MBLAC2; Acyl-CoA thioesterase MBLAC2; Beta-lactamase MBLAC2; Metallo-beta-lactamase domain-containing protein 2; Palmitoyl-coenzyme A thioesterase MBLAC2; EC 3.1.2.2; EC 3.5.2.6 from Homo sapiens (Human) (see 3 papers)
28% identity, 69% coverage: 57:204/215 of query aligns to 82:239/279 of Q68D91
Sites not aligning to the query:
>GFF1215 FitnessBrowser__Marino:GFF1215
MSLNYRIIPVTPFQQNCSLIWCEKTRRAAVVDPGGDLEKIRAAVAEEGVTVEKILLTHAH
IDHAGGTAELTKELGIPIEGPQKEDNFWIVGLPQQAQMFGFPAPEVFTPDRWLEDGQQVT
VGNQTLEVLHCPGHTPGHVVFYHKESGLALVGDVLFHGSIGRTDFPKGDHATLIRSIREQ
LFPLGDEVAFIPGHGPMSTFGRERATNPFVSDHRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory