SitesBLAST
Comparing GFF123 FitnessBrowser__Phaeo:GFF123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
81% identity, 98% coverage: 1:246/252 of query aligns to 1:246/246 of 1efpB
- binding adenosine monophosphate: P6 (= P6), V7 (= V7), D39 (= D39), I63 (= I63), V101 (= V101), A119 (= A119), G120 (= G120), Q122 (= Q122), A123 (= A123), N126 (= N126), M128 (= M128), N129 (= N129), T131 (= T131)
- binding flavin-adenine dinucleotide: Y13 (= Y13), L182 (= L182)
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
56% identity, 100% coverage: 1:252/252 of query aligns to 4:255/255 of Q9DCW4
- K200 (= K197) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K200) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
56% identity, 100% coverage: 1:252/252 of query aligns to 4:255/255 of P38117
- A9 (≠ P6) binding
- NPFC 39:42 (≠ NPFD 36:39) binding
- C66 (≠ I63) binding
- 123:134 (vs. 120:131, 75% identical) binding
- D128 (= D125) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ D151) to M: in dbSNP:rs1130426
- R164 (= R161) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (= E162) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 180:202, 87% identical) Recognition loop
- L195 (= L192) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (= K197) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (= KAK 197:199) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (= KAKK 197:200) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (= K200) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
56% identity, 100% coverage: 1:252/252 of query aligns to 4:255/255 of Q2TBV3
- K200 (= K197) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K200) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
56% identity, 100% coverage: 1:252/252 of query aligns to 1:252/252 of 2a1uB
- binding adenosine monophosphate: A6 (≠ P6), V7 (= V7), K8 (= K8), C39 (≠ D39), C63 (≠ I63), V101 (= V101), L119 (≠ A119), G120 (= G120), Q122 (= Q122), A123 (= A123), D126 (≠ N126), C128 (≠ M128), N129 (= N129), Q130 (≠ A130), T131 (= T131)
- binding flavin-adenine dinucleotide: P37 (= P37), L182 (= L182)
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
37% identity, 85% coverage: 1:213/252 of query aligns to 1:215/264 of P53570
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
37% identity, 85% coverage: 1:213/252 of query aligns to 1:214/261 of 1o96A
- binding adenosine monophosphate: A6 (≠ P6), V7 (= V7), K8 (= K8), D38 (= D39), V63 (vs. gap), V99 (= V101), A117 (= A119), G118 (= G120), Q120 (= Q122), S121 (≠ A123), Y126 (≠ M128), A127 (≠ N129), T129 (= T131)
- binding flavin-adenine dinucleotide: Q120 (= Q122), Q182 (≠ D181)
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
32% identity, 98% coverage: 1:248/252 of query aligns to 1:258/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (≠ P6), A7 (≠ V7), K8 (= K8), D38 (= D39), T61 (≠ S62), M62 (≠ I63), A93 (≠ I96), D94 (≠ E97), T95 (≠ P98), T98 (≠ V101), L102 (= L105), G118 (= G120), Q120 (= Q122), G124 (≠ N126), T126 (≠ M128), A127 (≠ N129), V129 (≠ T131), T223 (≠ R218)
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
34% identity, 93% coverage: 3:236/252 of query aligns to 4:247/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (≠ P6), I8 (≠ V7), K9 (= K8), D39 (= D39), M62 (≠ I63), A93 (≠ I96), D94 (≠ E97), T95 (≠ P98), T98 (≠ V101), L102 (= L105), T121 (≠ A119), G122 (= G120), A125 (= A123), G128 (≠ N126), T130 (≠ M128), G131 (≠ N129), V133 (≠ T131)
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
32% identity, 79% coverage: 1:198/252 of query aligns to 1:194/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (≠ P6), I7 (≠ V7), K8 (= K8), D38 (= D39), M61 (≠ I63), A92 (≠ I96), D93 (≠ E97), T94 (≠ P98), T97 (≠ V101), A115 (= A119), G116 (= G120), A119 (= A123), G122 (≠ N126), T124 (≠ M128), A125 (≠ N129), V127 (≠ T131)
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
33% identity, 98% coverage: 1:248/252 of query aligns to 1:257/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (≠ P6), V7 (= V7), K8 (= K8), Y37 (≠ F38), D38 (= D39), Y40 (≠ I41), T60 (≠ S62), M61 (≠ I63), A92 (≠ I96), D93 (≠ E97), T94 (≠ P98), T97 (≠ V101), M101 (≠ L105), C116 (≠ A119), G117 (= G120), Q119 (= Q122), A120 (= A123), G123 (≠ N126), T125 (≠ M128), A126 (≠ N129), V128 (≠ T131)
- binding nicotinamide-adenine-dinucleotide: M61 (≠ I63), G62 (= G64), P63 (≠ V65), S85 (≠ A89), D86 (= D90), G91 (≠ D95)
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
33% identity, 98% coverage: 1:248/252 of query aligns to 1:257/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (≠ P6), V7 (= V7), K8 (= K8), Y37 (≠ F38), D38 (= D39), Y40 (≠ I41), M61 (≠ I63), A92 (≠ I96), D93 (≠ E97), T94 (≠ P98), T97 (≠ V101), C116 (≠ A119), G117 (= G120), Q119 (= Q122), A120 (= A123), G123 (≠ N126), T125 (≠ M128), A126 (≠ N129), V128 (≠ T131)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 80% coverage: 2:202/252 of query aligns to 3:201/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (≠ P6), K9 (= K8), D39 (= D39), M62 (≠ I63), D94 (= D95), V95 (≠ I96), L102 (= L105), G118 (= G120), Q120 (= Q122), T121 (≠ A123), T126 (≠ M128), A127 (≠ N129), V129 (≠ T131)
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
31% identity, 67% coverage: 38:205/252 of query aligns to 38:201/251 of 5ow0B
- binding adenosine monophosphate: D39 (= D39), Y62 (≠ I63), I95 (≠ V101), A114 (= A119), G115 (= G120), Q117 (= Q122), S118 (≠ A123), R123 (≠ M128), G124 (≠ N129), V125 (≠ A130), V126 (≠ T131), P127 (≠ G132)
- binding flavin-adenine dinucleotide: Y38 (≠ F38)
Sites not aligning to the query:
Query Sequence
>GFF123 FitnessBrowser__Phaeo:GFF123
MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVV
VSIGVKQAQETLRTALAMGADRAILVNAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG
KQAIDNDMNATGQMLSALLGWSQGTFASELDVDGDNAVVTREVDGGLQTIKVKMPAIVTV
DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVSPRLEIISTTEPAARAAGIIVGSVD
ELVGKLKEAGAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory