Comparing GFF1236 FitnessBrowser__psRCH2:GFF1236 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
28% identity, 93% coverage: 10:254/264 of query aligns to 6:261/276 of Q9NQR4
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 82% coverage: 10:225/264 of query aligns to 1:219/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 82% coverage: 10:225/264 of query aligns to 1:219/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
30% identity, 82% coverage: 10:225/264 of query aligns to 2:220/262 of Q9UYV8
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
30% identity, 75% coverage: 27:225/264 of query aligns to 20:221/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
30% identity, 75% coverage: 27:225/264 of query aligns to 26:227/269 of 6ypaB
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 75% coverage: 23:219/264 of query aligns to 49:262/307 of Q94JV5
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
28% identity, 78% coverage: 40:244/264 of query aligns to 51:262/339 of O25067
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
28% identity, 70% coverage: 40:225/264 of query aligns to 51:243/346 of P11436
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
27% identity, 70% coverage: 40:225/264 of query aligns to 34:223/254 of 4izuA
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
27% identity, 70% coverage: 40:225/264 of query aligns to 42:231/263 of 4iztA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
27% identity, 70% coverage: 40:225/264 of query aligns to 41:230/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
27% identity, 70% coverage: 40:225/264 of query aligns to 41:230/262 of 5ny7A
Sites not aligning to the query:
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
27% identity, 70% coverage: 40:225/264 of query aligns to 41:230/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
27% identity, 70% coverage: 40:225/264 of query aligns to 41:230/261 of 4izsA
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 69% coverage: 23:203/264 of query aligns to 18:226/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
26% identity, 69% coverage: 23:203/264 of query aligns to 15:223/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
26% identity, 69% coverage: 23:203/264 of query aligns to 15:223/304 of 4hg3A
O25836 Formamidase; Formamide amidohydrolase; EC 3.5.1.49 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
25% identity, 72% coverage: 40:228/264 of query aligns to 52:246/334 of O25836
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
24% identity, 80% coverage: 40:249/264 of query aligns to 51:268/340 of 4gylA
>GFF1236 FitnessBrowser__psRCH2:GFF1236
MRDLNNLPDLELALVQTSLIWQDAAANHERFATLLDQASGADLIVLPEMFTTGFSMESSA
LAEPEEGATYAWLRTQAARLEAVITGSVIIEAADGSHRNRLLWARPDGEVLHYDKRHLFR
MAGEHKHYTPGQQQALFELNGWRVRPLICYDLRFPVWSRDPHGTDLLLYTANWPAARRDA
WNRLLPARAIENLCYVAAVNRVGEDGKGYPYSGDSQVLDFKGDTLLNGEDRDAVLRCTLR
ARDLAAFRERFPAYHDGDEFELKF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory