Comparing GFF1247 FitnessBrowser__WCS417:GFF1247 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
69% identity, 99% coverage: 2:279/281 of query aligns to 1:276/277 of 3s8yA
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
69% identity, 99% coverage: 2:279/281 of query aligns to 1:276/278 of 3i6yA
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
60% identity, 99% coverage: 3:280/281 of query aligns to 1:277/278 of P33018
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
58% identity, 99% coverage: 3:279/281 of query aligns to 5:282/284 of Q8LAS8
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
56% identity, 99% coverage: 1:279/281 of query aligns to 1:280/282 of P10768
3fcxB Crystal structure of human esterase d (see paper)
54% identity, 99% coverage: 3:279/281 of query aligns to 1:274/275 of 3fcxB
Sites not aligning to the query:
3fcxA Crystal structure of human esterase d (see paper)
54% identity, 99% coverage: 1:279/281 of query aligns to 1:266/268 of 3fcxA
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
48% identity, 98% coverage: 6:279/281 of query aligns to 5:277/278 of 3e4dA
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 95% coverage: 13:279/281 of query aligns to 11:296/299 of P40363
Sites not aligning to the query:
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
43% identity, 95% coverage: 13:279/281 of query aligns to 11:285/288 of 4flmA
Sites not aligning to the query:
4rotA Crystal structure of esterase a from streptococcus pyogenes
30% identity, 55% coverage: 20:174/281 of query aligns to 14:153/268 of 4rotA
Sites not aligning to the query:
7xrtA Bacteroides thetaiotaomicron ferulic acid esterase (bt_4077)
28% identity, 74% coverage: 23:231/281 of query aligns to 13:220/268 of 7xrtA
Sites not aligning to the query:
6wcxA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, substrate bound (see paper)
25% identity, 89% coverage: 14:263/281 of query aligns to 3:240/255 of 6wcxA
6vhdA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, kt129 bound (see paper)
25% identity, 89% coverage: 14:263/281 of query aligns to 3:240/255 of 6vhdA
7l0aA Crystal structure of s-formylglutathione hydrolase (frmb) from staphylococcus aureus, apoenzyme (see paper)
25% identity, 86% coverage: 20:261/281 of query aligns to 15:233/249 of 7l0aA
>GFF1247 FitnessBrowser__WCS417:GFF1247
MSLENLSCQKSFGGWHKRYKHHSDVLGCDMTFAVYLPPQAEQGSKLPVLYWLSGLTCTDE
NFMQKAGAQRMAAELGLIIVAPDTSPRGPGVPGDPDNAWDFGLGAGFYLNATQEPWAKHY
RMHDYVVQELPALVEAHFPASDKRGISGHSMGGHGALVCALRNPGRYLSVSAFSPINNPM
DCPWGQKAFSRYLGEERSKWREWDACVLISEASEKLPLLVDQGDRDDFLAVQLKPEALQQ
AAKAANHPLELRLQPGYDHSYFFIASFIEDHLRHHGRALLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory