SitesBLAST
Comparing GFF1257 HP15_1232 fatty acid oxidation complex subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
54% identity, 98% coverage: 2:705/716 of query aligns to 15:729/731 of 4b3iA
- active site: G79 (= G66), E100 (≠ N87), R104 (≠ S91), G127 (= G114), E130 (= E117), P151 (= P138), E152 (= E139), G160 (= G147), S452 (= S431), H473 (= H452), E485 (= E464), S523 (= S502)
- binding adenosine-5'-diphosphate: Q640 (≠ T622), P641 (≠ V623), P642 (≠ K624), L643 (= L625), Q644 (= Q626)
- binding coenzyme a: T38 (≠ A25), V40 (≠ T27), A77 (= A64), G79 (= G66), D80 (= D67), V81 (≠ L68), E152 (= E139), F315 (≠ W294), Q319 (≠ N298)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
54% identity, 98% coverage: 2:705/716 of query aligns to 12:726/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
54% identity, 98% coverage: 2:705/716 of query aligns to 12:726/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ T27), N39 (= N29), G75 (= G65), D77 (= D67), M81 (≠ L71), V92 (≠ F82), T95 (≠ M85), P148 (= P138), E149 (= E139), L152 (= L142), Q180 (≠ E169), Q260 (≠ K243), K362 (= K344), D363 (= D345), V364 (= V346), V430 (= V412), D476 (= D458), K477 (= K459), M478 (= M460), P479 (≠ Q461), K506 (= K488)
- binding formamide: V78 (≠ L68), K79 (= K69)
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G65), G77 (= G66), T81 (≠ E70), M82 (≠ L71), M82 (≠ L71), A85 (≠ V74), D89 (= D78), T96 (≠ M85), L123 (= L112), G124 (= G113), P149 (= P138), E150 (= E139), S366 (= S347), L367 (≠ V348), E368 (= E349), A420 (= A401), V421 (= V402), F422 (= F403)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G65), F169 (≠ I158), N173 (≠ A162), S177 (≠ P165), I193 (≠ A181), F313 (≠ W294)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (= M28), N40 (= N29), E41 (≠ A30), T81 (≠ E70), D92 (≠ T81), V93 (≠ F82)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (= M28), G77 (= G66), D78 (= D67), M82 (≠ L71), V93 (≠ F82)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (= T141), R184 (≠ K172), A311 (≠ T292), F312 (= F293), I673 (= I657)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
54% identity, 98% coverage: 2:705/716 of query aligns to 14:728/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (= M28), N41 (= N29), E42 (≠ A30), G77 (= G65), G78 (= G66), D79 (= D67), V80 (≠ L68), D90 (= D78), V94 (≠ F82), L124 (= L112), G125 (= G113), P150 (= P138), E151 (= E139)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ A30), G76 (= G65), G77 (= G66), D78 (= D67), V79 (≠ L68), M82 (≠ L71), D89 (= D78), V93 (≠ F82), T96 (≠ M85), T96 (≠ M85), P149 (= P138), E150 (= E139)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (= M28), M82 (≠ L71), E150 (= E139), Q172 (≠ E161), F175 (= F164), V176 (vs. gap), Q181 (≠ E169), T241 (≠ A223), F254 (≠ A236), N257 (≠ M239), Q261 (≠ K243), L262 (≠ T244), P266 (vs. gap), P268 (= P249), Q282 (= Q263), V283 (= V264), G302 (= G283), Q303 (= Q284), V304 (= V285), S521 (= S502), G525 (= G506)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/729 of 8opvA
- binding resveratrol: M39 (= M28), A75 (= A64), G76 (= G65), M82 (≠ L71), E128 (= E117), P149 (= P138), E150 (= E139), T152 (= T141), L153 (= L142), R184 (≠ K172), F296 (= F277)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
54% identity, 98% coverage: 2:705/716 of query aligns to 13:727/729 of 8opuA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
54% identity, 98% coverage: 2:705/716 of query aligns to 19:733/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (= M28), I50 (≠ R33), G82 (= G65), G83 (= G66), D84 (= D67), T87 (≠ E70), T87 (≠ E70), M88 (≠ L71), M88 (≠ L71), A91 (≠ V74), D95 (= D78), D98 (≠ T81), V99 (≠ F82), T102 (≠ M85), T102 (≠ M85), E134 (= E117), E156 (= E139), L159 (= L142), F302 (= F277), F302 (= F277), F319 (≠ W294), S456 (= S431), T457 (= T432), M485 (= M460), P486 (≠ Q461), G523 (= G498), S527 (= S502), N535 (= N510), P560 (= P535), M575 (= M550), I578 (= I553), I578 (= I553), I682 (= I660), M683 (≠ F661), G686 (= G664)
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
54% identity, 98% coverage: 2:705/716 of query aligns to 11:725/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ A30), G74 (= G65), M80 (≠ L71), V91 (≠ F82), T94 (≠ M85), T94 (≠ M85), E148 (= E139), L151 (= L142), R182 (≠ K172), S448 (= S431), S519 (= S502), R520 (= R503), L562 (≠ V545), L566 (= L549), I570 (= I553)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
54% identity, 98% coverage: 2:705/716 of query aligns to 7:721/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
54% identity, 98% coverage: 2:705/716 of query aligns to 7:721/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ Q23), S29 (= S24), A63 (= A58), K64 (= K59), K64 (= K59), K65 (= K60), P143 (= P138), E144 (= E139), L147 (= L142), F307 (≠ W294), M473 (= M460), P548 (= P535), S599 (≠ K587), L602 (≠ A590), K603 (≠ A591), S661 (≠ T651), T662 (≠ V652), G674 (= G664), A698 (≠ R682), R705 (≠ S689)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
54% identity, 98% coverage: 2:705/716 of query aligns to 2:709/711 of 7o4uA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 99% coverage: 4:714/716 of query aligns to 41:757/763 of P40939
- V282 (≠ L233) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L255) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ T292) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E464) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
36% identity, 99% coverage: 2:707/716 of query aligns to 2:694/707 of 6yswA
- active site: A66 (≠ G66), I71 (≠ L71), A84 (≠ E83), Q88 (≠ N87), G112 (= G114), E115 (= E117), P136 (= P138), E137 (= E139), G145 (= G147), D264 (≠ L271), S422 (= S431), H443 (= H452), E455 (= E464), N493 (≠ S502)
- binding coenzyme a: E23 (≠ Q23), M25 (≠ A25), A66 (≠ G66), D67 (= D67), I68 (≠ L68), P136 (= P138), E137 (= E139), L140 (= L142), T290 (≠ L297), K293 (≠ I300)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
33% identity, 98% coverage: 13:715/716 of query aligns to 17:713/715 of 1wdlA
- active site: A69 (≠ G66), N89 (≠ G88), N93 (≠ H92), G117 (= G114), E120 (= E117), P139 (= P138), E140 (= E139), P147 (= P146), G148 (= G147), S430 (= S431), H451 (= H452), E463 (= E464), N501 (≠ S502)
- binding nicotinamide-adenine-dinucleotide: A322 (= A323), I324 (≠ M325), M325 (= M326), D344 (= D345), I345 (≠ V346), A400 (= A401), V401 (= V402), E403 (= E404), N428 (= N429), T429 (= T430), S430 (= S431)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
33% identity, 98% coverage: 13:715/716 of query aligns to 17:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
33% identity, 98% coverage: 13:715/716 of query aligns to 17:705/707 of 1wdmA
- active site: A69 (≠ G66), N89 (≠ G88), N93 (≠ H92), G117 (= G114), E120 (= E117), P139 (= P138), E140 (= E139), P147 (= P146), G148 (= G147), S430 (= S431), H451 (= H452), E463 (= E464), N501 (≠ S502)
- binding acetyl coenzyme *a: K142 (≠ T141), D297 (≠ L297), M459 (= M460), N501 (≠ S502), P534 (= P535), Y652 (≠ F661), L658 (≠ P667)
- binding nicotinamide-adenine-dinucleotide: G321 (= G322), A322 (= A323), I324 (≠ M325), M325 (= M326), D344 (= D345), V401 (= V402), E403 (= E404), N428 (= N429), S430 (= S431), N454 (≠ S455)
Query Sequence
>GFF1257 HP15_1232 fatty acid oxidation complex subunit alpha
MSAIRYELGSDQILTLTIDMPGQSANTMNAAFRDALSETAAKVKEDLDNIRGIIIASAKK
TFFAGGDLKELHKVTREDARTFEDMVNGLKSHMRFLETTGKPVVAAINGSALGGGLEIAL
ACHYRVAINDDSIQLGLPEVTLGLLPGGGGTQRLPRMIGLEAAFPFLMEGKKVNPKAALK
AGIINELADSADDMITKARAFIEANPKCQQPWDQKGFRFPGGAPHHPAMAQKLAIAPAML
KQKTKGCYPAPERILSAAVEGAQVDFDNGSLIETRYFAELVIGQVAKNMTGTFWFQLNAI
KAGGSRPEGVEKETFRKVGVLGAGMMGAGIAYSTATRGIDVVLKDVSVENAEKGKSYSEN
LLAKKVSRGRMTEEQKADILSRIKATDSSDDLEGCDLVIEAVFEDSGLKAKVTQEAEPKL
VANGIFASNTSTIPITQLAGASANAENFIGLHFFSPVDKMQLVEIIVGEKTSDETLARSF
DYVQQIGKIPVVVNDSRGFFTSRVFGTFVNEGICMLGEGIHPASIENAGVLAGMPVGPLA
ISDEVSMTLMQHIRDQSRKDTEAAGGTWNPHPAEAVIDAMVNEHGRKGKAAGAGFYEYPA
NGKKHLWPELETLFVNAEKARTVKLQELKDRILFIQAIETVRCLEEGVLRTVEDANIGSI
FGIGYAPWTGGAIQFINQYGVRAFTERASALAETYGERFAPPKLLQEKAETNTPFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory