Comparing GFF126 FitnessBrowser__WCS417:GFF126 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 67% coverage: 38:226/283 of query aligns to 41:236/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 67% coverage: 38:226/283 of query aligns to 41:236/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
40% identity, 67% coverage: 38:227/283 of query aligns to 41:237/260 of 7ahdC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 73% coverage: 20:226/283 of query aligns to 4:208/393 of P9WQI3
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 69% coverage: 41:236/283 of query aligns to 35:229/378 of P69874
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
37% identity, 73% coverage: 20:226/283 of query aligns to 3:207/362 of 8hprD
8hprC Lpqy-sugabc in state 4 (see paper)
37% identity, 73% coverage: 20:226/283 of query aligns to 3:207/363 of 8hprC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 68% coverage: 36:227/283 of query aligns to 19:217/375 of 2d62A
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 67% coverage: 38:226/283 of query aligns to 16:205/384 of 8hplC
Sites not aligning to the query:
1g291 Malk (see paper)
37% identity, 68% coverage: 36:227/283 of query aligns to 16:214/372 of 1g291
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 67% coverage: 38:227/283 of query aligns to 21:203/353 of 1vciA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 66% coverage: 42:227/283 of query aligns to 20:210/240 of 4ymuJ
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 74% coverage: 19:227/283 of query aligns to 1:219/232 of 1f3oA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 73% coverage: 19:225/283 of query aligns to 3:215/226 of 5xu1B
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 74% coverage: 19:227/283 of query aligns to 1:219/230 of 1l2tA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 69% coverage: 32:227/283 of query aligns to 14:210/241 of 4u00A
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
37% identity, 65% coverage: 41:223/283 of query aligns to 18:198/348 of 3d31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 69% coverage: 19:214/283 of query aligns to 1:202/343 of P30750
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 66% coverage: 42:227/283 of query aligns to 22:212/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
39% identity, 66% coverage: 42:227/283 of query aligns to 22:212/242 of 3c41J
Sites not aligning to the query:
>GFF126 FitnessBrowser__WCS417:GFF126
MNAPLQGHTASNLHTTAPLLAVDHVSLEYRTPERVVRATHQVSFEIDPADRYVLLGPSGC
GKSTLLKSIAGFIKPCEGEIRLLGQKVDQPGPDRIVVFQEFDQLPPWKTVKQNVMFPLLA
SKTLKRAEAEERALHYLDKVGLTAFADAYPHTLSGGMKARVAIARALAMQPKILLMDEPF
AALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRAEIHSH
QYDLHSLGGVEFQASARRIHRLLFDEAPEAERELGFADIRIAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory