SitesBLAST
Comparing GFF1270 FitnessBrowser__Marino:GFF1270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
66% identity, 98% coverage: 7:395/396 of query aligns to 4:391/392 of P33221
- EL 22:23 (= EL 25:26) binding
- E82 (= E85) binding
- R114 (= R117) binding
- K155 (= K158) binding
- SSGKGQ 160:165 (= SSGKGQ 163:168) binding
- G162 (= G165) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ E182) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFV 198:201) binding
- E203 (= E206) binding
- E267 (= E270) binding
- E279 (= E282) binding
- D286 (= D289) binding
- K355 (= K359) binding
- RR 362:363 (= RR 366:367) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
66% identity, 98% coverage: 7:395/396 of query aligns to 3:388/389 of 1kjiA
- active site: E114 (= E118), K154 (= K158), S159 (= S163), G161 (= G165), E264 (= E270), E276 (= E282), D283 (= D289), T284 (= T290), R360 (= R367)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R117), I152 (≠ V156), K154 (= K158), S159 (= S163), S160 (= S164), G161 (= G165), Q164 (= Q168), E192 (= E198), V195 (= V201), E200 (= E206), Q222 (= Q228), E264 (= E270), F266 (= F272), E276 (= E282)
- binding magnesium ion: E264 (= E270), E276 (= E282)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
66% identity, 98% coverage: 7:395/396 of query aligns to 3:388/389 of 1ez1A
- active site: E114 (= E118), K154 (= K158), S159 (= S163), G161 (= G165), E264 (= E270), E276 (= E282), D283 (= D289), T284 (= T290), R360 (= R367)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R117), I152 (≠ V156), K154 (= K158), S159 (= S163), S160 (= S164), G161 (= G165), E192 (= E198), V194 (≠ F200), V195 (= V201), F197 (= F203), E200 (= E206), Q222 (= Q228), E264 (= E270), F266 (= F272), E276 (= E282)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S164), D283 (= D289), K352 (= K359), R359 (= R366), R360 (= R367)
- binding magnesium ion: E264 (= E270), E276 (= E282)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
66% identity, 98% coverage: 7:395/396 of query aligns to 3:388/389 of 1eyzA
- active site: E114 (= E118), K154 (= K158), S159 (= S163), G161 (= G165), E264 (= E270), E276 (= E282), D283 (= D289), T284 (= T290), R360 (= R367)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R117), I152 (≠ V156), K154 (= K158), S159 (= S163), S160 (= S164), G161 (= G165), Q164 (= Q168), E192 (= E198), V195 (= V201), F197 (= F203), E200 (= E206), E264 (= E270), F266 (= F272), E276 (= E282)
- binding magnesium ion: E264 (= E270), E276 (= E282)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
65% identity, 98% coverage: 7:395/396 of query aligns to 3:387/388 of 1kjqA
- active site: E114 (= E118), K154 (= K158), E263 (= E270), E275 (= E282), D282 (= D289), T283 (= T290), R359 (= R367)
- binding adenosine-5'-diphosphate: R113 (= R117), I152 (≠ V156), K154 (= K158), E191 (= E198), V193 (≠ F200), V194 (= V201), F196 (= F203), E199 (= E206), Q221 (= Q228), F265 (= F272), E275 (= E282)
- binding magnesium ion: E263 (= E270), E275 (= E282)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
65% identity, 98% coverage: 7:395/396 of query aligns to 3:385/386 of 1kjjA
- active site: E114 (= E118), K154 (= K158), S159 (= S163), G161 (= G165), E261 (= E270), E273 (= E282), D280 (= D289), T281 (= T290), R357 (= R367)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R117), I152 (≠ V156), K154 (= K158), S159 (= S163), S160 (= S164), G161 (= G165), Q164 (= Q168), E189 (= E198), V192 (= V201), E197 (= E206), Q219 (= Q228), E261 (= E270), F263 (= F272), E273 (= E282)
- binding magnesium ion: E261 (= E270), E273 (= E282)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
65% identity, 98% coverage: 7:395/396 of query aligns to 3:385/386 of 1kj8A
- active site: E114 (= E118), K154 (= K158), S159 (= S163), G161 (= G165), E261 (= E270), E273 (= E282), D280 (= D289), T281 (= T290), R357 (= R367)
- binding adenosine-5'-triphosphate: R113 (= R117), I152 (≠ V156), K154 (= K158), S159 (= S163), S160 (= S164), G161 (= G165), Q164 (= Q168), E189 (= E198), V192 (= V201), F194 (= F203), E197 (= E206), Q219 (= Q228), G222 (= G231), E261 (= E270), F263 (= F272), E273 (= E282)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S164), D280 (= D289), K349 (= K359), R356 (= R366)
- binding magnesium ion: E261 (= E270), E273 (= E282)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
49% identity, 97% coverage: 7:392/396 of query aligns to 8:408/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
47% identity, 97% coverage: 7:392/396 of query aligns to 10:397/409 of 2dwcB
- active site: E265 (= E270), E277 (= E282), D284 (= D289), T285 (= T290), R372 (= R367)
- binding adenosine-5'-diphosphate: R120 (= R117), H159 (≠ V156), K161 (= K158), H190 (≠ F200), I191 (≠ V201), F193 (= F203), E196 (= E206), F267 (= F272), E277 (= E282)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
27% identity, 90% coverage: 30:385/396 of query aligns to 16:348/360 of 3ax6A
- active site: E231 (= E270), E244 (= E282), N251 (≠ D289), S252 (≠ T290), K330 (≠ R367)
- binding adenosine-5'-diphosphate: K101 (≠ R117), V136 (= V156), K138 (= K158), E164 (= E198), F166 (= F200), V167 (= V201), E172 (= E206), F233 (= F272), N243 (≠ S281)
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
29% identity, 88% coverage: 35:381/396 of query aligns to 24:367/381 of 3k5iA
- active site: E254 (= E270), E267 (= E282), N274 (≠ D289), S275 (≠ T290), K353 (≠ R367)
- binding adenosine-5'-diphosphate: K104 (≠ R117), K146 (= K158), Y152 (≠ S163), D153 (≠ S164), G154 (= G165), W183 (≠ F200), A184 (≠ V201), F186 (= F203), E189 (= E206), Q211 (= Q228), S214 (≠ G231), E267 (= E282)
- binding 5-aminoimidazole ribonucleotide: E73 (= E85), I74 (= I86), Y152 (≠ S163), D153 (≠ S164), R155 (≠ K166), R271 (= R286), K345 (= K359), R352 (= R366)
- binding magnesium ion: E254 (= E270), E267 (= E282)
Sites not aligning to the query:
3k5hA Crystal structure of carboxyaminoimidazole ribonucleotide synthase from asperigillus clavatus complexed with atp (see paper)
29% identity, 88% coverage: 35:381/396 of query aligns to 24:367/382 of 3k5hA
- active site: Y152 (≠ S163), G154 (= G165), E254 (= E270), E267 (= E282), N274 (≠ D289), S275 (≠ T290), K353 (≠ R367)
- binding adenosine-5'-triphosphate: K104 (≠ R117), K146 (= K158), Y152 (≠ S163), D153 (≠ S164), G154 (= G165), N157 (≠ Q168), E181 (= E198), W183 (≠ F200), A184 (≠ V201), F186 (= F203), E189 (= E206), E254 (= E270), F256 (= F272), E267 (= E282)
- binding magnesium ion: E254 (= E270), E267 (= E282)
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 91% coverage: 25:386/396 of query aligns to 17:366/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R117), K146 (= K158), Y152 (vs. gap), G154 (= G165), Q157 (= Q168), W183 (≠ F200), V184 (= V201), E189 (= E206), N215 (≠ G231), F256 (= F272), N266 (≠ S281), E267 (= E282)
- binding carbonate ion: R271 (= R286), H273 (= H288), N274 (≠ D289)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 91% coverage: 25:386/396 of query aligns to 18:367/377 of 3q2oB
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 91% coverage: 25:386/396 of query aligns to 19:368/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R117), K148 (= K158), Y154 (vs. gap), D155 (≠ S164), G156 (= G165), Q159 (= Q168), E183 (= E198), W185 (≠ F200), V186 (= V201), F188 (= F203), E191 (= E206), H214 (≠ Q228), N217 (≠ G231), E256 (= E270), F258 (= F272), E269 (= E282)
- binding carbonate ion: R273 (= R286), H275 (= H288), N276 (≠ D289)
- binding magnesium ion: T105 (= T114), E111 (≠ R121), E256 (= E270), E269 (= E282), L270 (≠ V283)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 91% coverage: 25:386/396 of query aligns to 18:367/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R117), K147 (= K158), Q158 (= Q168), W184 (≠ F200), V185 (= V201), F187 (= F203), E190 (= E206), N216 (≠ G231), F257 (= F272), N267 (≠ S281), E268 (= E282)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E25), L19 (= L26), E76 (= E85), Y153 (vs. gap), R272 (= R286), K340 (= K359), R347 (= R366)
Sites not aligning to the query:
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 91% coverage: 25:386/396 of query aligns to 18:367/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G165), E255 (= E270), E268 (= E282), N275 (≠ D289), S276 (≠ T290), K348 (≠ R367)
- binding adenosine-5'-triphosphate: E76 (= E85), F77 (≠ I86), R107 (= R117), K147 (= K158), Y153 (vs. gap), D154 (≠ S164), G155 (= G165), Q158 (= Q168), W184 (≠ F200), V185 (= V201), F187 (= F203), E190 (= E206), E255 (= E270), F257 (= F272), N267 (≠ S281), E268 (= E282), R272 (= R286), H274 (= H288), N275 (≠ D289), K340 (= K359), R347 (= R366), K348 (≠ R367)
- binding calcium ion: E255 (= E270), E268 (= E282)
- binding phosphate ion: Q47 (= Q54), A49 (= A56)
3orqA Crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus complexed with adp (see paper)
24% identity, 87% coverage: 25:369/396 of query aligns to 21:352/373 of 3orqA
- active site: Y156 (vs. gap), E256 (= E270), E269 (= E282), N276 (≠ D289), S277 (≠ T290), K350 (≠ R367)
- binding adenosine-5'-diphosphate: R110 (= R117), K150 (= K158), Y156 (vs. gap), D157 (≠ S164), Q161 (= Q168), E185 (= E198), Y187 (≠ F200), L188 (≠ V201), I190 (≠ F203), E193 (= E206), H216 (≠ Y233), F258 (= F272), E269 (= E282)
- binding magnesium ion: E256 (= E270), E269 (= E282)
- binding pyrophosphate 2-: Y156 (vs. gap), K342 (= K359), R349 (= R366)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
32% identity, 66% coverage: 104:366/396 of query aligns to 84:329/360 of 3aw8A
- active site: E240 (= E270), E252 (= E282), N259 (≠ D289), S260 (≠ T290), K329 (≠ R366)
- binding adenosine monophosphate: L135 (≠ V156), K137 (= K158), Q142 (= Q168), F168 (= F200), V169 (= V201), E174 (= E206), H197 (≠ Q228), F242 (= F272), E252 (= E282)
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
29% identity, 59% coverage: 80:313/396 of query aligns to 62:290/373 of 4mamA
- active site: Y144 (≠ S163), G146 (= G165), E247 (= E270), E259 (= E282), N266 (≠ D289), S267 (≠ T290)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R117), I136 (≠ V156), K138 (= K158), Y144 (≠ S163), G146 (= G165), Q149 (= Q168), E175 (= E198), F177 (= F200), V178 (= V201), F180 (= F203), E183 (= E206), H206 (≠ Q228), F249 (= F272), E259 (= E282)
Sites not aligning to the query:
Query Sequence
>GFF1270 FitnessBrowser__Marino:GFF1270
MTDSVRIGTPLKGNAFKVLFCGSGELGKEVVIELQRYGVEVIAVDRYADAPAMQVAHRSH
VIDMLDGASLRSVIEQEKPDLIVPEIEAIATPELVKLEEEGYRVIPTARAVNLTMNREGI
RRLAAEELGLPTSPYRFAGTREEYLAAVNEIGLPLVVKPVMSSSGKGQSTVKTEDDIEAA
WEYAQSGGRAGKGRVIVEGFVDFDYEITLLTVKHRDGVSFCEPIGHRQEDGDYRESWQPQ
PMAPLAYERSAEVARAVVENLGGYGIYGVELFVKEDNVWFSEVSPRPHDTGLVTLVSQDL
SEFALHARAILGLPIPAIRQTGPSASAVILPEGDSASVSYSGLESALSEPDTQLRLFGKP
ELKGRRRMGVALAKGATVDEARKKARDSANSVTVEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory