SitesBLAST
Comparing GFF1288 FitnessBrowser__Marino:GFF1288 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 95% coverage: 37:731/734 of query aligns to 10:719/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M65), G39 (= G66), Q40 (= Q67), H41 (≠ G68), V42 (≠ T69), A45 (≠ G72), G79 (= G110), G80 (= G111), S81 (= S112), S83 (= S114), V84 (= V115), G374 (= G392), F375 (= F393), L379 (= L397), L499 (≠ W532), R500 (= R533), V624 (= V636), D625 (≠ N637), Q632 (= Q644), T687 (= T699), G688 (= G700), L689 (≠ V701), G690 (= G702), E691 (= E703)
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 52% coverage: 189:570/734 of query aligns to 3:386/420 of 3hrdE
- active site: Q207 (= Q362), L242 (= L397), R318 (≠ L484), H322 (≠ G488), R350 (= R533)
- binding calcium ion: T206 (= T361), N208 (≠ A363), D212 (≠ G367), K241 (≠ R396), L242 (= L397), D243 (≠ T398)
- binding pterin cytosine dinucleotide: G237 (= G392), F238 (= F393), R350 (= R533)
- binding selenium atom: F238 (= F393), A348 (vs. gap), F349 (≠ W532), R350 (= R533)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 52% coverage: 189:570/734 of query aligns to 3:386/420 of 3hrdA
- active site: Q207 (= Q362), L242 (= L397), R318 (≠ L484), H322 (≠ G488), R350 (= R533)
- binding pterin cytosine dinucleotide: G236 (= G391), G237 (= G392), F238 (= F393), R350 (= R533)
- binding magnesium ion: T206 (= T361), N208 (≠ A363), D212 (≠ G367), K241 (≠ R396), L242 (= L397), D243 (≠ T398), T305 (≠ A469), Y308 (≠ Q472), A309 (≠ Y473), S346 (≠ T530)
- binding nicotinic acid: A314 (≠ K478), R318 (≠ L484), F352 (≠ V535)
- binding selenium atom: F238 (= F393), G239 (= G394), A348 (vs. gap), F349 (≠ W532), R350 (= R533)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 52% coverage: 189:570/734 of query aligns to 4:387/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
34% identity, 19% coverage: 594:730/734 of query aligns to 609:753/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
34% identity, 19% coverage: 594:730/734 of query aligns to 601:745/761 of 1rm6A
- active site: E718 (vs. gap), G719 (vs. gap)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V636), N647 (= N637), V651 (= V641), Q654 (= Q644), K714 (≠ G702), E715 (= E703), A716 (≠ P704), S717 (≠ G705), E718 (vs. gap)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
22% identity, 52% coverage: 193:576/734 of query aligns to 7:387/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
33% identity, 17% coverage: 603:730/734 of query aligns to 183:316/330 of 3hrdB
- active site: E289 (= E703), P290 (= P704)
- binding pterin cytosine dinucleotide: I215 (≠ V636), N216 (= N637), M219 (≠ I640), V220 (= V641), Q223 (= Q644), K285 (≠ T699), G286 (= G700), V287 (= V701), G288 (= G702), E289 (= E703)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
33% identity, 17% coverage: 603:730/734 of query aligns to 183:316/330 of Q0QLF1
- 211:223 (vs. 632:644, 38% identical) binding
- AKGVGE 284:289 (≠ -TGVGE 699:703) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
33% identity, 17% coverage: 604:731/734 of query aligns to 564:696/701 of 4zohA
Sites not aligning to the query:
- active site: 186, 219, 298, 300, 304, 332
- binding pterin cytosine dinucleotide: 213, 214, 215, 332, 442, 443, 444, 446, 482, 484, 486, 487
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 25% coverage: 262:444/734 of query aligns to 696:880/1361 of Q8GUQ8
- E831 (≠ L397) mutation to A: Loss of activity.
Sites not aligning to the query:
- 364 W→A: Decreases activity 8-fold.
- 421 Y→A: Decreases activity 4-fold.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
23% identity, 52% coverage: 185:563/734 of query aligns to 10:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
22% identity, 52% coverage: 185:563/734 of query aligns to 10:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
7px0B Drosophila melanogaster aldehyde oxidase 1
23% identity, 56% coverage: 204:611/734 of query aligns to 560:967/1253 of 7px0B
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 220, 221, 223, 224, 225, 226, 227, 266, 298, 299, 303, 307, 308, 310, 311, 312, 314, 322, 324, 325, 363, 364, 383, 1162
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 67, 69, 108, 109, 110, 112, 145, 147
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
24% identity, 35% coverage: 185:443/734 of query aligns to 540:825/1307 of 2e1qA
- active site: Q742 (= Q362), V777 (≠ L397)
- binding bicarbonate ion: R814 (= R432), H815 (≠ P433)
- binding calcium ion: E715 (≠ A337), H716 (= H338), Y718 (≠ T340), T741 (= T361), T747 (≠ G367), S780 (≠ D400), T781 (≠ Y401), S784 (≠ E404), T811 (≠ D429), G812 (≠ L430)
- binding fe2/s2 (inorganic) cluster: L719 (= L341)
- binding hydroxy(dioxo)molybdenum: F773 (= F393), G774 (= G394)
Sites not aligning to the query:
- active site: 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 852, 886, 889, 890, 893
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 887, 1053, 1054, 1236
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
31% identity, 16% coverage: 604:721/734 of query aligns to 654:780/804 of 1zxiB
Sites not aligning to the query:
- active site: 235, 270, 347, 353, 382, 383
- binding copper (ii) ion: 383, 384
- binding cu(i)-s-mo(vi)(=o)oh cluster: 266, 267, 380, 381, 382, 383, 563, 564
- binding pterin cytosine dinucleotide: 265, 266, 382, 523, 524, 525, 527, 530, 562, 563, 565, 567, 568
2ckjA Human milk xanthine oxidoreductase
24% identity, 35% coverage: 185:443/734 of query aligns to 509:794/1264 of 2ckjA
Sites not aligning to the query:
- active site: 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
24% identity, 35% coverage: 185:443/734 of query aligns to 566:851/1333 of P47989
- D584 (≠ R203) to A: in dbSNP:rs45491693
- R607 (vs. gap) to Q: in dbSNP:rs45442092
- K617 (vs. gap) to N: in dbSNP:rs45442398
- T623 (≠ V226) to I: in dbSNP:rs45448694
- I646 (≠ M247) to V: in dbSNP:rs17323225
- I703 (≠ Y298) to V: in dbSNP:rs17011368
- L763 (≠ V357) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N385) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
30% identity, 16% coverage: 604:721/734 of query aligns to 655:781/805 of 1n63B
Sites not aligning to the query:
- active site: 236, 271, 348, 354, 383, 384
- binding cu(i)-s-mo(iv)(=o)oh cluster: 268, 381, 383, 384, 564, 565
- binding pterin cytosine dinucleotide: 266, 267, 383, 524, 525, 526, 528, 531, 563, 564, 566, 568, 569
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
30% identity, 16% coverage: 604:721/734 of query aligns to 653:779/803 of 1n60B
Sites not aligning to the query:
- active site: 234, 269, 346, 352, 381, 382
- binding pterin cytosine dinucleotide: 264, 265, 381, 522, 523, 524, 526, 529, 561, 562, 563, 564, 566, 567
- binding mo(vi)(=o)(oh)2 cluster: 265, 266, 562, 563
Query Sequence
>GFF1288 FitnessBrowser__Marino:GFF1288
MAMNRRNFLKVSAGASGSLMVSITLPGCAGIQTGYEPDTGEWRPDAWLELTADDEVFFTL
ARVEMGQGTYTGLTTLIAEELEIQPERITPRFAPVAPEYRNPLYKLQLTGGSTSVATSWE
PLRTAGAEARQMLVMAAARVWNVEATECRASEGRVVHPNGIDSMAYGQLVELAAKEVLRG
DIALKPQSEWKYIGKQRGKLDARAKSTGTAVYGIDVDLPDMVYGVVSRPPRRGGRVRDFN
ADQVRAMTGVLDVFKIERGVAVVADKYWRARKAQDALKIDWDFSDAVSLSTGDVFDSYRA
AADDDPGESERSEGSFASAMEEGDRVVEAEYAQPYLAHATLEPMNATAWYREDGMEVWAP
TQAPDLGRIAAARVTNLGPDDITINTTFLGGGFGRRLTQDYIEEAAAVAYRVGRPVKVIW
SREEDTRHDLYRPAMLHRMKASLSGAELKGWHHQIVGPQILDWYVRNAAPAQYPWAPKFM
YDTLGSVGLMAEGIATPKDHSAIEGAIEYPYRVPNIDIRHTHTDPGIPITWWRSVGFSHN
GFAVETFMDELAHEAGEDPYRFRRRLIAHEPRHLEVLDRVVRLADWQSPVPEGRARGLAL
FRSFGTYVAQVVEAGIENGAIRVYKVTCSVDCGQVVNPRIVEDQIEGGILFGLTAALYGE
ITLENGEVQQSNFHDYRLMRQYERPEVLVDIVASSESPTGVGEPGVPPVIPALGNALFAL
NGKRQRSLPLRANA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory