Comparing GFF1300 FitnessBrowser__Phaeo:GFF1300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
39% identity, 100% coverage: 1:486/488 of query aligns to 1:489/492 of 1m2wA
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
39% identity, 100% coverage: 1:486/488 of query aligns to 1:489/492 of 1lj8A
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
36% identity, 100% coverage: 1:487/488 of query aligns to 3:499/501 of 7rk5B
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
36% identity, 96% coverage: 18:485/488 of query aligns to 10:480/483 of 4im7A
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
26% identity, 46% coverage: 149:372/488 of query aligns to 71:293/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
26% identity, 49% coverage: 147:386/488 of query aligns to 74:311/388 of Q4X1A4
>GFF1300 FitnessBrowser__Phaeo:GFF1300
MKLSNDTLSQLPQTIGRPSYDRAEISPGIVHIGLGNFHRAHQAWYLHALMQSGLAMDWGI
IGAGVRAADAGMRDRLLAQDCLTTLIELDPTGRSAEVIGPLIDFLPVEADNASLIRCMAG
SPIRIVSLTVTEGGYYQDAQHKGLDLNHEDIRHDIARPDRPRTVFGAIVEALRLRRGRGL
PAFTVQSCDNLQGNGQITRTAVVTLAQQTDPELAAWIDQTGAFPNSMVDCIVPATGPAEI
ALARGYGIEDTAPVTHENYRHWVIEDEFCAGRPPWDLAGAIFTDDVHGYESMKIRVLNAG
HQVLANAGELLSIATIADCMKDPLLAAFFRTVQTAEILPHVIAVPEMAPKDYLTLIEARF
SNPEIRDTTRRVAYDGSSRHPGFVMPILRDAVRSKGAIDGLCLVEALWAQMCTGLREDAS
EIAPNDPDWETRKSAAERAQKNPEVWLQQSQIYGDLSEQPGVVERFSYWLSMIRSQGCRA
ALSEYLGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory