SitesBLAST
Comparing GFF1301 PGA1_c13170 sorbitol dehydrogenase PolS to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
73% identity, 100% coverage: 1:257/257 of query aligns to 1:257/257 of 6pejA
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
39% identity, 96% coverage: 7:253/257 of query aligns to 3:252/256 of 1gegE
- active site: G13 (= G17), S139 (= S140), Y152 (= Y153), K156 (= K157), V197 (≠ F198)
- binding alpha-D-glucopyranose: R63 (≠ Q64), D64 (≠ A65), F67 (≠ D68), E123 (≠ Q124)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), Q12 (≠ R16), I14 (= I18), D33 (= D37), Y34 (≠ I38), V58 (≠ L59), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), I109 (= I110), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), V185 (= V186), T187 (≠ G188), M189 (≠ H190)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
39% identity, 96% coverage: 7:253/257 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 10:37, 50% identical) binding
- D59 (= D60) binding
- K156 (= K157) binding
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
40% identity, 96% coverage: 7:253/257 of query aligns to 2:251/255 of 3wyeA
- active site: G12 (= G17), S138 (= S140), Y151 (= Y153), K155 (= K157), L196 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), G12 (= G17), I13 (= I18), D32 (= D37), Y33 (≠ I38), V57 (≠ L59), D58 (= D60), V59 (= V61), N85 (= N87), A86 (= A88), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), V184 (= V186), T186 (≠ G188), M188 (≠ H190), W189 (= W191)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
38% identity, 98% coverage: 4:256/257 of query aligns to 5:257/258 of 3ak4A
- active site: G18 (= G17), S141 (= S140), L151 (≠ V150), Y154 (= Y153), K158 (= K157), E199 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (≠ I38), V60 (≠ L59), D61 (= D60), V62 (= V61), N88 (= N87), A89 (= A88), G90 (≠ A89), T139 (≠ M138), S141 (= S140), Y154 (= Y153), K158 (= K157), G185 (= G184), V187 (= V186), T189 (≠ G188), M191 (≠ H190)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
41% identity, 96% coverage: 7:253/257 of query aligns to 3:254/258 of Q9ZNN8
- QGI 12:14 (≠ RGI 16:18) binding
- D33 (= D37) binding
- Q37 (≠ A41) binding
- DV 61:62 (= DV 60:61) binding
- N88 (= N87) binding
- I142 (≠ Q141) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (≠ E147) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y153) binding
- K158 (= K157) binding
- PGIVGT 184:189 (≠ PGVVDG 183:188) binding
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
41% identity, 96% coverage: 7:253/257 of query aligns to 2:253/257 of 3a28C
- active site: G12 (= G17), S140 (= S140), Y153 (= Y153), K157 (= K157), L198 (≠ F198)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), I13 (= I18), D32 (= D37), L33 (≠ I38), Q36 (≠ A41), L59 (= L59), D60 (= D60), V61 (= V61), N87 (= N87), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), V186 (= V186), T188 (≠ G188), M190 (≠ H190), W191 (= W191)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 100% coverage: 1:256/257 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S140), Q149 (≠ V150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ A93), K98 (≠ E98), S139 (= S140), N146 (≠ E147), V147 (≠ P148), Q149 (≠ V150), Y152 (= Y153), F184 (≠ V185), M189 (≠ F197), K200 (≠ Q208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ L59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (≠ A89), I90 (≠ V90), T137 (≠ M138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ V185), T185 (≠ V186), T187 (≠ D195), M189 (≠ F197)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
39% identity, 98% coverage: 1:253/257 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ A15), K21 (≠ R16), G22 (= G17), I23 (= I18), A43 (≠ D39), S44 (≠ T40), S45 (≠ A41), G68 (≠ L59), D69 (= D60), V70 (= V61), N96 (= N87), S97 (≠ A88), G98 (≠ A89), Y100 (≠ F91), I144 (≠ M138), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), M191 (vs. gap), I192 (vs. gap), T194 (≠ V186), G196 (= G188), T197 (≠ E189)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S140), Y159 (= Y153), M191 (vs. gap), I202 (≠ V194)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
38% identity, 98% coverage: 7:257/257 of query aligns to 6:254/256 of 7do7A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (= R16), G16 (= G17), I17 (= I18), S37 (≠ A36), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ V90), V144 (≠ M138), S145 (≠ A139), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (≠ V186), T194 (≠ F197), I196 (≠ A199)
- binding beta-L-rhamnopyranose: F99 (≠ A93), S146 (= S140), S148 (≠ A142), Q156 (≠ V150), Y159 (= Y153), N197 (≠ K200), D235 (≠ E238), M236 (≠ D239), R238 (≠ D241)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
38% identity, 98% coverage: 7:257/257 of query aligns to 6:254/256 of 7b81A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (≠ A15), R15 (= R16), I17 (= I18), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ V90), T116 (≠ I110), V144 (≠ M138), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (≠ V186), T194 (≠ F197), I196 (≠ A199)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 98% coverage: 3:253/257 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G17), S141 (= S140), Y154 (= Y153), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (≠ L59), I63 (≠ V61), N89 (= N87), G91 (≠ A89), T139 (≠ M138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I186 (≠ V185), I187 (≠ V186)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 6:245/247 of 7do6A
- active site: G16 (= G17), S146 (= S140), Y159 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (= R16), G16 (= G17), I17 (= I18), H36 (vs. gap), S37 (≠ A36), G42 (≠ A41), D66 (= D60), A67 (≠ V61), N93 (= N87), A94 (= A88), G95 (≠ A89), I96 (≠ V90), T116 (≠ I110), S146 (= S140), Y159 (= Y153), K163 (= K157), I192 (≠ V186)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
36% identity, 100% coverage: 1:256/257 of query aligns to 5:253/262 of 3pk0B
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
35% identity, 98% coverage: 3:253/257 of query aligns to 2:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (≠ R16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (= V61), N89 (= N87), A91 (= A89), S94 (≠ T92), I142 (≠ M138), S143 (≠ A139), S144 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), H188 (≠ D192), I190 (≠ V194), I194 (≠ F198)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 98% coverage: 3:253/257 of query aligns to 5:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (= R16), G19 (= G17), I20 (= I18), D39 (= D37), R40 (≠ I38), C63 (≠ L59), I65 (≠ V61), N91 (= N87), G93 (≠ A89), I94 (≠ V90), V114 (≠ I110), Y155 (= Y153), K159 (= K157), I188 (≠ V186), T190 (≠ G188), T193 (≠ W191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 97% coverage: 7:256/257 of query aligns to 5:246/246 of 3osuA
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
37% identity, 98% coverage: 2:253/257 of query aligns to 3:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
37% identity, 98% coverage: 2:253/257 of query aligns to 1:243/247 of 2ewmB
- active site: G16 (= G17), S139 (= S140), Y149 (≠ V150), Y152 (= Y153), K156 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ R16), G16 (= G17), I17 (= I18), D36 (= D37), L37 (≠ I38), C59 (≠ L59), D60 (= D60), V61 (= V61), N87 (= N87), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), S183 (≠ G184), L184 (≠ V185), V185 (= V186), T189 (≠ H190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 97% coverage: 7:256/257 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S140), Q148 (≠ V150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ A15), R11 (= R16), I13 (= I18), N31 (≠ A36), Y32 (≠ D37), A33 (≠ I38), G34 (≠ D39), S35 (≠ T40), A58 (≠ L59), N59 (≠ D60), V60 (= V61), N86 (= N87), A87 (= A88), T109 (≠ I110), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
Query Sequence
>GFF1301 PGA1_c13170 sorbitol dehydrogenase PolS
MKRLSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQIGAAAIAVELD
VTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMMQ
AAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVNA
IAPGVVDGEHWDGVDAFFAKYEGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVFLASEDA
DYVVAQTYNVDGGQWMS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory