SitesBLAST
Comparing GFF1319 FitnessBrowser__Phaeo:GFF1319 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
54% identity, 53% coverage: 101:224/233 of query aligns to 2:125/125 of 1y80A
- active site: D15 (= D114), H17 (= H116), T68 (= T167)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D114), L16 (≠ I115), H17 (= H116), D18 (= D117), I19 (= I118), G20 (= G119), V24 (= V123), G60 (= G159), M61 (= M160), S62 (= S161), L64 (= L163), L65 (= L164), T66 (= T165), I91 (≠ L190), G93 (= G192), G94 (= G193), A95 (= A194), P112 (≠ R211), D113 (= D212), A114 (= A213)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
36% identity, 89% coverage: 14:221/233 of query aligns to 2:211/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D114), I105 (= I115), H106 (= H116), I108 (= I118), G109 (= G119), V113 (= V123), S150 (≠ M160), S151 (= S161), L153 (= L163), M154 (≠ L164), T155 (= T165), M180 (≠ L190), G182 (= G192), G183 (= G193), G200 (≠ C210), S202 (≠ D212), A203 (= A213)
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
36% identity, 74% coverage: 52:224/233 of query aligns to 38:205/206 of 4jgiB
- active site: D95 (= D114), H97 (= H116), A148 (≠ T167)
- binding co-methylcobalamin: L63 (≠ V77), D95 (= D114), L96 (≠ I115), H97 (= H116), D98 (= D117), I99 (= I118), G100 (= G119), F104 (≠ V123), G140 (= G159), S142 (= S161), L145 (= L164), G173 (= G192), G174 (= G193), V175 (≠ A194), S191 (≠ C210), T192 (≠ R211), N193 (≠ D212), A194 (= A213)
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
36% identity, 79% coverage: 18:200/233 of query aligns to 2:179/507 of 8sseA
Sites not aligning to the query:
- binding cobalamin: 405, 409, 451, 452, 453, 454, 463, 485, 488, 490, 492
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
30% identity, 90% coverage: 16:225/233 of query aligns to 37:243/258 of 2i2xB
- active site: D134 (= D114), H136 (= H116), T187 (= T167)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G113), D134 (= D114), V135 (≠ I115), H136 (= H116), D137 (= D117), I138 (= I118), G139 (= G119), V143 (= V123), T179 (≠ G159), T181 (≠ S161), L183 (= L163), M184 (≠ L164), T185 (= T165), A208 (≠ I188), G210 (= G192), G211 (= G193), G212 (≠ A194), G228 (≠ C210), E229 (≠ R211), E230 (≠ D212), A231 (= A213)
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
30% identity, 90% coverage: 16:225/233 of query aligns to 37:243/258 of Q46EH4
- H129 (≠ G109) mutation to K: Does not affect cobalamin-binding.
- H136 (= H116) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 83% coverage: 2:194/233 of query aligns to 643:835/1227 of P13009
- E694 (≠ T53) binding
- GDVHD 756:760 (≠ GDIHD 113:117) binding
- D757 (= D114) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H116) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S161) binding
- T808 (= T165) binding
- S810 (≠ T167) mutation to A: Decreases activity by about 40%.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 860 binding
- 946 binding
- 1134 binding
- 1189:1190 binding
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
33% identity, 79% coverage: 11:194/233 of query aligns to 2:185/576 of 3ivaA
- active site: D107 (= D114), H109 (= H116), S160 (≠ T167)
- binding cobalamin: H109 (= H116), G112 (= G119), V116 (= V123), G152 (= G159), L153 (≠ M160), S154 (= S161), L156 (= L163), I157 (≠ L164), T158 (= T165), G183 (= G192), G184 (= G193)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 303, 443, 486, 488, 489, 495, 520, 521, 524, 527, 528
- binding s-adenosyl-l-homocysteine: 447, 484, 485, 489, 491, 539
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
33% identity, 79% coverage: 11:194/233 of query aligns to 2:185/577 of 3bulA
- active site: D107 (= D114), H109 (= H116), S160 (≠ T167)
- binding cobalamin: H109 (= H116), V116 (= V123), G152 (= G159), L153 (≠ M160), S154 (= S161), L156 (= L163), I157 (≠ L164), T158 (= T165), G183 (= G192), G184 (= G193)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 210, 213, 302, 443, 486, 487, 488, 489, 495, 498, 521, 524, 527, 528
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
33% identity, 81% coverage: 11:198/233 of query aligns to 2:189/246 of 1bmtA
- active site: D107 (= D114), H109 (= H116), S160 (≠ T167)
- binding co-methylcobalamin: E44 (≠ T53), M48 (≠ V57), M51 (= M60), G55 (= G64), L65 (≠ V74), V68 (= V77), D107 (= D114), V108 (≠ I115), H109 (= H116), D110 (= D117), I111 (= I118), I115 (≠ L122), G152 (= G159), L153 (≠ M160), S154 (= S161), L156 (= L163), I157 (≠ L164), T158 (= T165), G183 (= G192), G184 (= G193), A185 (= A194)
Sites not aligning to the query:
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
33% identity, 80% coverage: 20:205/233 of query aligns to 3:193/212 of 3ezxA
- active site: D100 (= D114), H102 (= H116), S155 (≠ T167)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M60), F54 (= F67), D100 (= D114), I101 (= I115), H102 (= H116), D103 (= D117), I104 (= I118), V109 (= V123), V147 (≠ G159), S149 (= S161), L151 (= L163), M152 (≠ L164), T153 (= T165), M178 (≠ L190), G180 (= G192), G181 (= G193)
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
34% identity, 80% coverage: 15:200/233 of query aligns to 628:805/841 of 8g3hA
- binding cobalamin: F675 (= F67), V685 (= V77), K693 (= K85), G720 (= G113), V722 (≠ I115), H723 (= H116), D724 (= D117), I725 (= I118), G726 (= G119), V730 (= V123), M767 (= M160), S768 (= S161), L770 (= L163), V772 (≠ T165), I795 (≠ L190), L796 (≠ V191), G797 (= G192), G798 (= G193), A799 (= A194)
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
34% identity, 63% coverage: 48:194/233 of query aligns to 704:861/1265 of Q99707
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
- 382:384 binding
- 449 binding
- 470 binding
- 537 binding
- 579 binding
- 585 binding
- 591 binding
- 919 D → G: in dbSNP:rs1805087
- 963 D→E: Decreases binding to MTRR; when associated with N-1071.
- 1071 K→N: Decreases binding to MTRR; when associated with E-963.
1i9cA Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate (see paper)
34% identity, 25% coverage: 105:163/233 of query aligns to 5:63/137 of 1i9cA
- active site: V10 (≠ T110), D14 (= D114), H16 (= H116)
- binding cobalamin: S13 (≠ G113), D14 (= D114), C15 (≠ I115), H16 (= H116), A17 (≠ D117), G19 (= G119), L23 (≠ V123), S61 (= S161), L63 (= L163)
Sites not aligning to the query:
Query Sequence
>GFF1319 FitnessBrowser__Phaeo:GFF1319
MSEDADDIILADLNDEDLVQQMFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGM
TIVGADFRDGILFVPEVLLAANAMKGGMAILKPLLAETGAPRMGSMVIGTVKGDIHDIGK
NLVSMMMEGAGFEVVDIGINNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIE
QGKRDDYIVLVGGAPLNEEFGKAIGADGYCRDAAVAVEMAKDFVARKHNQMSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory