Comparing GFF1321 FitnessBrowser__Phaeo:GFF1321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
32% identity, 90% coverage: 9:313/338 of query aligns to 10:306/559 of 1q8jA
Sites not aligning to the query:
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
32% identity, 90% coverage: 9:313/338 of query aligns to 10:306/560 of 3bofA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
31% identity, 78% coverage: 37:298/338 of query aligns to 68:344/1265 of Q99707
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
28% identity, 85% coverage: 11:297/338 of query aligns to 10:305/841 of 8g3hA
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
28% identity, 78% coverage: 37:298/338 of query aligns to 51:304/611 of 4cczA
Sites not aligning to the query:
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 76% coverage: 37:294/338 of query aligns to 54:326/1227 of P13009
Sites not aligning to the query:
O09171 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 75% coverage: 41:293/338 of query aligns to 50:314/407 of O09171
Sites not aligning to the query:
1umyD Bhmt from rat liver (see paper)
27% identity, 75% coverage: 41:293/338 of query aligns to 41:291/381 of 1umyD
1lt8A Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine (see paper)
26% identity, 75% coverage: 41:293/338 of query aligns to 40:291/348 of 1lt8A
Sites not aligning to the query:
Q93088 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Homo sapiens (Human) (see 4 papers)
27% identity, 75% coverage: 41:293/338 of query aligns to 50:314/406 of Q93088
4m3pA Betaine-homocysteine s-methyltransferase from homo sapiens complexed with homocysteine (see paper)
26% identity, 75% coverage: 41:293/338 of query aligns to 41:283/370 of 4m3pA
Sites not aligning to the query:
5dmmA Crystal structure of the homocysteine methyltransferase mmum from escherichia coli, metallated form (see paper)
26% identity, 85% coverage: 3:290/338 of query aligns to 1:285/288 of 5dmmA
>GFF1321 FitnessBrowser__Phaeo:GFF1321
MTNTFTTLLETKDALLADGATGTNLFNMGLQSGDAPELWNVDEPKKITALYQGAVDAGSD
LFLTNTFGGTAARLKLHDAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQP
VGELSHALAVEMFHEQAEALKEGGVDVLWLETISAPEEYRAAAEAFKLADMPWCGTMSFD
TAGRTMMGVTSADMAQLVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISKGN
AGIPKYVDGHIHYDGTPTLMGEYAAMARDCGAKIIGGCCGTMPDHLRAMREALDTRPRGE
QLTLERIVEVLGPFTSDSDGTGEDTAPDRRSRRGRRRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory