Comparing GFF1323 FitnessBrowser__WCS417:GFF1323 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 37% coverage: 82:240/431 of query aligns to 90:233/582 of O23492
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 36% coverage: 84:240/431 of query aligns to 93:234/580 of Q9C757
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 62% coverage: 4:272/431 of query aligns to 20:283/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 77% coverage: 48:379/431 of query aligns to 32:381/446 of A0A0H2VG78
Sites not aligning to the query:
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
22% identity, 65% coverage: 84:362/431 of query aligns to 100:409/512 of Q6PXP3
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
26% identity, 42% coverage: 47:227/431 of query aligns to 55:216/487 of 7aaqA
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 34% coverage: 82:227/431 of query aligns to 105:236/514 of Q9LT15
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
26% identity, 42% coverage: 47:227/431 of query aligns to 60:221/485 of 7aarA
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 39% coverage: 64:230/431 of query aligns to 88:262/583 of Q9Y7Q9
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
26% identity, 70% coverage: 80:380/431 of query aligns to 78:390/452 of Q5EXK5
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
24% identity, 70% coverage: 74:374/431 of query aligns to 76:405/496 of P11169
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
24% identity, 70% coverage: 74:374/431 of query aligns to 73:402/468 of 7spsA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
24% identity, 70% coverage: 74:374/431 of query aligns to 76:405/470 of 4zw9A
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
24% identity, 70% coverage: 74:374/431 of query aligns to 74:403/469 of 7crzA
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
24% identity, 70% coverage: 74:374/431 of query aligns to 76:405/470 of 7sptA
Sites not aligning to the query:
>GFF1323 FitnessBrowser__WCS417:GFF1323
MTTTTSHYTGEERSKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDDPTVQLLN
TAGVFAAGFLMRPIGGWLFGRVADKHGRKNSMMISVLMMCAGSLVIAFLPTYKDIGAWAP
ALLLVARLFQGLSVGGEYGTTATYMSEVALKGQRGFFASFQYVTLIGGQLLAVLVVVILQ
QILTEEELRAWGWRIPFVIGAIAAVISLLLRRTLKETTSKETRQDKDAGSVAALFRNHKA
AFITVLGYTAGGSLIFYTFTTYMQKYLVNTAGMHAKTASYIMTGALFVYMCMQPLFGMLS
DKIGRRNSMLWFGALGTLCTVPILLTLKTVTNPFLAFVLISLALAIVSFYTSISGLVKAE
MFPPHVRALGVGLAYAVANAIFGGSAEYVALGLKSMGMENTFYWYVTGMMAVAFLFSLRL
PKQAEYLHHDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory