Comparing GFF1325 FitnessBrowser__WCS417:GFF1325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
48% identity, 99% coverage: 1:260/263 of query aligns to 1:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 99% coverage: 1:260/263 of query aligns to 1:263/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 99% coverage: 1:260/263 of query aligns to 1:260/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 99% coverage: 1:260/263 of query aligns to 1:257/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
27% identity, 96% coverage: 8:260/263 of query aligns to 14:267/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
27% identity, 96% coverage: 8:260/263 of query aligns to 14:267/278 of 4uhfA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
27% identity, 96% coverage: 8:260/263 of query aligns to 14:267/274 of 4uhdA
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
24% identity, 83% coverage: 20:237/263 of query aligns to 18:240/267 of Q9SQR3
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
23% identity, 98% coverage: 2:260/263 of query aligns to 3:266/269 of 5h3hB
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 10:269/276 of 1iunB
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 2d0dA
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
27% identity, 97% coverage: 6:260/263 of query aligns to 9:268/271 of 1iupA
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
25% identity, 87% coverage: 19:248/263 of query aligns to 15:251/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
25% identity, 87% coverage: 19:248/263 of query aligns to 15:251/266 of 5dj5A
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
25% identity, 87% coverage: 19:248/263 of query aligns to 13:249/264 of 5zhsA
6brtA F-box protein cth with hydrolase (see paper)
25% identity, 87% coverage: 19:248/263 of query aligns to 34:270/285 of 6brtA
>GFF1325 FitnessBrowser__WCS417:GFF1325
MAFVQLAEGELHYQLDGPEGAPVLVLSNSLGTDLHMWDLQIPAFTQHFRVLRFDTRGHGK
SLVTPGPYSIEQLGQDVIALLDALDIQRAHFCGLSMGGLIGQWLGINAGQRLQRLVVCNT
AAKIGTPEVWNPRIEMVLRDGAAAMVALRDASIARWFTADFAAANPYQAKQITDMLAATS
PEGYAANCAAVRDADFREQLASITVPTLVIAGTEDAVTPPAGSHFIQNHVQGAEYAEFYA
AHLSNVQAGAAFSDCVIEFLLGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory