Comparing GFF1326 FitnessBrowser__Marino:GFF1326 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3if2A Crystal structure of putative amino-acid aminotransferase (yp_265399.1) from psychrobacter arcticum 273-4 at 2.50 a resolution
48% identity, 98% coverage: 1:418/425 of query aligns to 2:434/437 of 3if2A
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
24% identity, 92% coverage: 27:415/425 of query aligns to 28:399/404 of 3wx9A
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
24% identity, 92% coverage: 27:415/425 of query aligns to 28:399/404 of 3av7A
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
24% identity, 92% coverage: 27:415/425 of query aligns to 28:399/404 of 3aowC
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
24% identity, 92% coverage: 27:415/425 of query aligns to 28:399/404 of 3aovA
3eleA Crystal structure of amino transferase (rer070207001803) from eubacterium rectale at 2.10 a resolution
24% identity, 87% coverage: 39:407/425 of query aligns to 43:386/398 of 3eleA
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
27% identity, 54% coverage: 186:415/425 of query aligns to 176:397/403 of 1wstA
Sites not aligning to the query:
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
23% identity, 94% coverage: 27:424/425 of query aligns to 34:416/420 of 1vp4A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
21% identity, 77% coverage: 84:412/425 of query aligns to 80:393/402 of P14909
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
24% identity, 96% coverage: 1:407/425 of query aligns to 1:377/388 of 1j32A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
23% identity, 91% coverage: 27:412/425 of query aligns to 33:380/384 of 1o4sB
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 46% coverage: 30:223/425 of query aligns to 30:206/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 46% coverage: 30:223/425 of query aligns to 30:206/382 of 1bkgA
Sites not aligning to the query:
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 46% coverage: 30:223/425 of query aligns to 30:206/382 of 1bjwA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 46% coverage: 30:223/425 of query aligns to 30:206/382 of 1b5oA
Sites not aligning to the query:
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 46% coverage: 29:223/425 of query aligns to 29:206/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 46% coverage: 29:223/425 of query aligns to 29:206/382 of 1gc3A
Sites not aligning to the query:
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
27% identity, 81% coverage: 72:417/425 of query aligns to 66:389/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
27% identity, 81% coverage: 72:417/425 of query aligns to 66:389/392 of 2egyA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
27% identity, 81% coverage: 72:417/425 of query aligns to 70:393/397 of 2zyjA
Sites not aligning to the query:
>GFF1326 FitnessBrowser__Marino:GFF1326
MKLSAFGRKFTADAGITSLMDDLGNAMASGDDMIMMGGGNPGHIPEIQQRVQEILADMSR
NEGDVRRLVGIYDPPQGEKQFIASLAELLNREYGWGLKPENIALTNGSQAAFFMLFNMFG
GDYGDGNRKHILLPLAPEYIGYADAGIEPGLFHAVQPDISFTDAHEFKYRVDFDAVEVTG
ETGAICVSRPTNPTGNVVTDEELARLEELARQHDIPLIVDGAYGTPFPSLLFVDAAPTWN
DQIILCLSLSKLGLPAARTGIVIAAEPVIKALSGINAIMNLATGSFGAMLAEPLVRSGEI
LSLSRDVVCPFYKAKMERAVSAFREAMGEDSCRWYVHKPEGAMFLWLWFPDLPISSLELY
QRLKSRGVLVVSGHYFFPGLPEDGWRHRHECLRVTYSQDDDRVAEGLRIIADEVKAVWRE
AGREV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory