SitesBLAST
Comparing GFF1351 FitnessBrowser__psRCH2:GFF1351 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
39% identity, 89% coverage: 43:404/409 of query aligns to 42:411/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R190), G195 (≠ W194), R282 (= R282)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S271), S272 (= S272), S273 (= S273), M307 (= M307), T310 (= T310), G353 (≠ S353), A354 (= A354), R394 (= R387), T395 (= T388)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
39% identity, 89% coverage: 43:404/409 of query aligns to 43:412/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
39% identity, 89% coverage: 43:404/409 of query aligns to 45:414/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
39% identity, 89% coverage: 43:404/409 of query aligns to 45:414/427 of 5e9sA
- binding aspartic acid: R274 (≠ S271), S275 (= S272), S276 (= S273), T313 (= T310), G353 (= G350), V354 (≠ I351), A357 (= A354), G358 (= G355), D394 (= D384), R397 (= R387), T398 (= T388)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R190), G198 (≠ W194), Y202 (≠ L198)
- binding sodium ion: Y87 (≠ F86), T90 (= T89), S91 (≠ T90), S276 (= S273), G305 (= G302), A306 (= A303), T307 (= T304), N309 (= N306), N309 (= N306), M310 (= M307), D311 (= D308), S348 (= S345), I349 (≠ T346), G350 (= G347), T351 (≠ A348), N401 (= N391), V402 (= V392), D405 (= D395)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
35% identity, 97% coverage: 7:404/409 of query aligns to 15:414/425 of O59010
- S65 (= S61) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S271) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 271:273) binding
- M311 (= M307) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T310) binding
- V355 (≠ I351) binding
- D394 (= D384) binding
- M395 (≠ T385) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R387) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N391) binding
- D405 (= D395) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 97% coverage: 7:404/409 of query aligns to 6:405/407 of 2nwwA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
39% identity, 89% coverage: 43:404/409 of query aligns to 38:403/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S271), S265 (= S273), M299 (= M307), T302 (= T310), T340 (≠ A348), G342 (= G350), V343 (≠ I351), G347 (= G355), D383 (= D384), R386 (= R387), T387 (= T388), N390 (= N391)
- binding decyl-beta-d-maltopyranoside: V212 (≠ L219), A216 (≠ G223)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 97% coverage: 7:404/409 of query aligns to 12:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G65), V83 (≠ L83), I157 (≠ F162), Y164 (vs. gap), K193 (≠ R190), T305 (= T304), I306 (≠ M305), I347 (≠ T346)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I8), M199 (= M196), S275 (= S273), T311 (= T310), G356 (= G355), L384 (= L377), D391 (= D384), R394 (= R387)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 97% coverage: 7:404/409 of query aligns to 15:414/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L41), F46 (≠ L41), P75 (≠ A71), L91 (= L88), F95 (≠ A92), L130 (= L127), I133 (≠ F136), I159 (≠ M161), Y167 (vs. gap), K196 (≠ R190), G200 (≠ W194), I207 (≠ L201), F210 (≠ L204), L250 (= L245), I262 (≠ F257), M269 (≠ L264), T334 (≠ S330), V335 (≠ L331), G336 (≠ A332), T340 (≠ V336), L343 (≠ F339), M399 (≠ A389)
- binding aspartic acid: S277 (= S272), S278 (= S273), T314 (= T310), G354 (= G350), A358 (= A354), G359 (= G355), D394 (= D384), R397 (= R387), T398 (= T388)
- binding sodium ion: Y89 (≠ F86), T92 (= T89), S93 (≠ T90), G306 (= G302), T308 (= T304), N310 (= N306), N310 (= N306), M311 (= M307), D312 (= D308), S349 (= S345), I350 (≠ T346), T352 (≠ A348), N401 (= N391), V402 (= V392), D405 (= D395)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 97% coverage: 7:404/409 of query aligns to 7:406/408 of 6bauA
- binding cysteine: S270 (= S273), M303 (= M307), T306 (= T310), A345 (≠ P349), G346 (= G350), V347 (≠ I351), G351 (= G355), D386 (= D384), C389 (≠ R387), T390 (= T388), N393 (= N391)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 97% coverage: 7:404/409 of query aligns to 7:406/409 of 6bavA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
39% identity, 96% coverage: 15:408/409 of query aligns to 33:404/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ Q74), G89 (≠ H76), G92 (≠ W79), A95 (= A82), V96 (≠ L83), Y99 (≠ F86), M163 (= M161), F167 (≠ I165), F293 (= F297), V297 (≠ L301)
- binding aspartic acid: S268 (= S272), S269 (= S273), T306 (= T310), G346 (= G350), I347 (= I351), A350 (= A354), G351 (= G355), D380 (= D384), R383 (= R387), T384 (= T388)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
36% identity, 94% coverage: 23:407/409 of query aligns to 19:400/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S61), L58 (≠ I62), L65 (= L69), V339 (≠ T346), G340 (= G347), S343 (≠ G350), I344 (= I351)
- binding cholesterol: W188 (≠ R197), I227 (≠ L234), F250 (= F257), W257 (≠ L264), M379 (≠ V386), S382 (≠ A389)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S273), M300 (= M307), T303 (= T310), Y306 (= Y313), G348 (= G355), L349 (≠ M356), M352 (= M359), I366 (≠ V373), L369 (= L376), V370 (≠ L377), D373 (= D380), D377 (= D384), R380 (= R387), T381 (= T388), N384 (= N391)
Sites not aligning to the query:
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
36% identity, 94% coverage: 23:407/409 of query aligns to 27:415/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S272), S281 (= S273), T318 (= T310), G363 (= G355), M367 (= M359), V385 (≠ L377), D388 (= D380), R395 (= R387), T396 (= T388)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R381)
- binding cholesterol hemisuccinate: R80 (= R77), R84 (≠ G81), I95 (≠ A92), I252 (= I244)
Sites not aligning to the query:
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
34% identity, 91% coverage: 33:406/409 of query aligns to 47:460/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (= N150) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
36% identity, 94% coverage: 23:407/409 of query aligns to 26:416/425 of 7xr4A
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
37% identity, 96% coverage: 15:408/409 of query aligns to 25:390/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V66), S80 (≠ Q74), G81 (≠ H76), G84 (≠ W79), Y91 (≠ F86), M156 (= M161), F160 (≠ I165), F286 (= F297), V290 (≠ L301)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I58), I148 (= I153), S262 (= S273), S263 (≠ A274), A292 (= A303), T293 (= T304), M296 (= M307), T299 (= T310), G329 (= G347), A336 (= A354), G337 (= G355), D366 (= D384), R369 (= R387), N373 (= N391)
6x2zA Heaat3-ofs-asp (see paper)
35% identity, 99% coverage: 5:408/409 of query aligns to 2:412/419 of 6x2zA
- binding aspartic acid: S275 (= S271), S277 (= S273), T314 (= T310), G354 (= G350), V355 (≠ I351), D388 (= D384), R391 (= R387), T392 (= T388)
- binding sodium ion: Y83 (≠ F86), T86 (= T89), T87 (= T90), G306 (= G302), A307 (= A303), T308 (= T304), I309 (≠ M305), N310 (= N306), N310 (= N306), M311 (= M307), M311 (= M307), D312 (= D308), S349 (= S345), I350 (≠ T346), G351 (= G347), A352 (= A348), N395 (= N391), D399 (= D395)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
35% identity, 99% coverage: 5:408/409 of query aligns to 4:407/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
35% identity, 99% coverage: 5:408/409 of query aligns to 1:404/406 of 8ctcA
- binding glutamic acid: S268 (= S272), S269 (= S273), M303 (= M307), T306 (= T310), G346 (= G350), A350 (= A354), D380 (= D384), R383 (= R387)
- binding sodium ion: Y82 (≠ F86), T85 (= T89), T86 (= T90), S269 (= S273), G298 (= G302), A299 (= A303), T300 (= T304), N302 (= N306), N302 (= N306), M303 (= M307), D304 (= D308), S341 (= S345), I342 (≠ T346), G343 (= G347), A344 (= A348), N387 (= N391), D391 (= D395)
Query Sequence
>GFF1351 FitnessBrowser__psRCH2:GFF1351
MPSLNLQILIAACLGVAIGWLTGTLPTDAPVREGVLYASTLAGSIFIGLLKMVLIPLIFT
SIVVGVANLQAHHQVHRVWGGALVYFTLTTSAAMLVALVAANLFKPGAGLSLDLFAEAMN
DFEARQLTLPEFFLHFFANLFQNPFAALANGSILAVVVFAMFIGIALVAGGDRYRNILVV
LQEFLELMMRIISWIMRLAPLGILALLIKLVAEQDVALLSAVGGFIALVFATTLFHGTVV
LPGILFLATGKSPLWFFRGTREALITAFATSSSAATLPISLRCAEDNLKVRPGIAGFVLP
LGATMNMDGTALYEAAAALFVANLMGIELSLAQQAVVFFTAMIASTGAPGIPSAGMVTMV
MVLQAVGLPAEAVAILLPIDRLLDTVRTAVNVEGDIIGSVVVQRFADRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory