Comparing GFF1354 FitnessBrowser__Phaeo:GFF1354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
35% identity, 48% coverage: 22:419/828 of query aligns to 17:410/412 of 7ru7A
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
28% identity, 48% coverage: 14:413/828 of query aligns to 5:392/405 of B4XMC6
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
29% identity, 45% coverage: 25:398/828 of query aligns to 20:383/384 of 6knhC
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
29% identity, 48% coverage: 14:413/828 of query aligns to 3:384/394 of 3c5qA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
27% identity, 49% coverage: 13:420/828 of query aligns to 18:414/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
26% identity, 49% coverage: 13:420/828 of query aligns to 16:389/393 of 4xg1A
6knkA Crystal structure of sbnh in complex with citryl-diaminoethane (see paper)
28% identity, 45% coverage: 25:398/828 of query aligns to 21:381/383 of 6knkA
6kniA Crystal structure of sbnh in complex with the cofactor plp, a plp- dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
28% identity, 45% coverage: 25:398/828 of query aligns to 20:379/381 of 6kniA
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
28% identity, 48% coverage: 12:411/828 of query aligns to 2:375/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 48% coverage: 12:411/828 of query aligns to 3:376/386 of Q9X1K5
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 48% coverage: 15:411/828 of query aligns to 27:423/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
25% identity, 48% coverage: 15:411/828 of query aligns to 23:419/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
25% identity, 48% coverage: 15:411/828 of query aligns to 23:419/434 of 1tufA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
29% identity, 50% coverage: 2:412/828 of query aligns to 10:411/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
29% identity, 50% coverage: 2:412/828 of query aligns to 9:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
29% identity, 50% coverage: 2:412/828 of query aligns to 9:410/421 of 1knwA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
26% identity, 49% coverage: 13:417/828 of query aligns to 31:443/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
26% identity, 49% coverage: 13:417/828 of query aligns to 30:442/446 of 1hkvA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
27% identity, 49% coverage: 11:416/828 of query aligns to 19:416/422 of 6n2aA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
25% identity, 48% coverage: 13:413/828 of query aligns to 36:447/458 of 8d5dA
>GFF1354 FitnessBrowser__Phaeo:GFF1354
MTDLFPDTDLRLIDEIATTAGTPFYLYDASVLRRRLDALRAALPQVDFFYSLKSNPNLSV
TRVLHGHGAGCEVSSLLELETSLQAGATPERILMVGPGKSETELTRAIELGIKAIVVESA
YELTQIDALARQQGRVQNIALRVNPDFHAGGAKLNMSGRPTQFGIDQSELPDVLKQAEGC
AQLRLCGLHAYMGTRILTHETVVANVGNILNLATEVVSSLKVPLDFVDVGGGFGIPYYDG
ETELDLDALGQAVTPLVQSFGTTHPKTRVVIELGRYLSGPSGQFVTRVQQTKSSKGEHFA
VCDGGSNVHVAAAGQGFLRKNFPIRLLRDGKAEIDDEAAQPWTLTGPLCTPQDVIGKSVL
MATPQVGDLISIGQSGAYGPTASPVNFLGFGAPAEVMIDGTELRLVRSRDTVEARLAGQQ
PSDLRLADHKNSSTGHAPAALADLYSSAPGNGLEGTPFSDPCLERLTGLQTLFRETGARL
DRDPESWTALWENPTVRALTTIGVPEKFNGFPLRDSGLGISDCPYGLHVAMVERLARFDA
NCILSLPGPSLSGGAVLATGTDAQIARFFDGYRFGPQGTFFAVTEPDAGSDASNGRSTLG
LKDGKLVLNGVKTLVGGIARADIGLFFAHIEETGRMGLVMIAPSDAPDCVKIERLGTNGL
RGADLCQMTLTDFPVTQDMILGSGGRSLRDGFMAINGVFERNRPMVAAMALGSGRGLIEL
MLEDPTRLPAYQDLLASHTALLVQLVKVIHAQENRRPKVQDISKVKMQAVSFVDQVVRRI
TDQDPMRFLQDAELRRRCRDVKAFEYMEGTSNIHLLNAYRSYTAGVDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory