Comparing GFF1354 FitnessBrowser__WCS417:GFF1354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
72% identity, 98% coverage: 5:289/290 of query aligns to 2:287/291 of 3na8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 98% coverage: 6:290/290 of query aligns to 2:286/292 of Q07607
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 98% coverage: 6:290/290 of query aligns to 2:286/291 of 3pueB
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
27% identity, 98% coverage: 6:290/290 of query aligns to 2:289/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
27% identity, 98% coverage: 6:290/290 of query aligns to 3:290/295 of 1o5kA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
30% identity, 90% coverage: 14:273/290 of query aligns to 17:274/297 of 5j5dA
Sites not aligning to the query:
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 90% coverage: 14:273/290 of query aligns to 20:277/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
30% identity, 90% coverage: 14:273/290 of query aligns to 16:273/296 of 1xxxA
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
26% identity, 96% coverage: 14:290/290 of query aligns to 22:299/306 of 7kkdB
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
26% identity, 96% coverage: 14:290/290 of query aligns to 12:289/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
26% identity, 96% coverage: 14:290/290 of query aligns to 12:289/296 of 6u01B
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
30% identity, 90% coverage: 14:273/290 of query aligns to 15:272/295 of 3l21B
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
26% identity, 96% coverage: 14:290/290 of query aligns to 12:289/296 of 7kg2A
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 81% coverage: 8:243/290 of query aligns to 4:240/294 of 4i7wA
Q704D1 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase; KD(P)G aldolase; EC 4.1.2.14; EC 4.1.2.51 from Thermoproteus tenax (see paper)
32% identity, 93% coverage: 9:277/290 of query aligns to 23:285/306 of Q704D1
>GFF1354 FitnessBrowser__WCS417:GFF1354
MSSPNIHGIIGYTITPFSTDGQRIDLNTLGRSIDRLIEGGVHAIAPLGSTGEGAYLSDAE
WDEVSAYSLAKIARRVPTIVSVSDLTTAKAVRRARYAEANGADVVMVLPTSYWKLSEAEI
LAHYAAIGDSIGVPIMLYNNPATSGTDMSVDLILRIIKQVPNVTMVKESTGDIQRMHHLH
RQSDVPFYNGCNPLALEAFAAGAKGWCTAAPNLIPELNLALYEAVLANDLTQAREVFYRQ
LPLLDFILKGGLPATIKAGLRLTGLEAGDPRLPVFPLGEVGIEQLKTLLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory