Comparing GFF1357 FitnessBrowser__psRCH2:GFF1357 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 92% coverage: 7:485/518 of query aligns to 3:474/501 of P04983
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 44% coverage: 2:230/518 of query aligns to 11:237/378 of P69874
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 45% coverage: 7:239/518 of query aligns to 2:232/369 of P19566
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 45% coverage: 7:239/518 of query aligns to 1:231/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 45% coverage: 7:239/518 of query aligns to 1:231/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 45% coverage: 7:239/518 of query aligns to 1:231/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 45% coverage: 7:239/518 of query aligns to 1:231/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 45% coverage: 7:239/518 of query aligns to 1:231/371 of 3puvA
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 45% coverage: 7:239/518 of query aligns to 2:232/371 of P68187
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 45% coverage: 9:239/518 of query aligns to 1:229/367 of 1q12A
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 41% coverage: 9:219/518 of query aligns to 4:217/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 41% coverage: 9:219/518 of query aligns to 4:217/229 of 6z67B
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 39% coverage: 27:228/518 of query aligns to 21:223/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 39% coverage: 27:228/518 of query aligns to 20:223/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 39% coverage: 27:230/518 of query aligns to 22:227/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 39% coverage: 27:230/518 of query aligns to 22:227/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 39% coverage: 27:230/518 of query aligns to 22:227/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 39% coverage: 27:230/518 of query aligns to 22:227/242 of 2oljA
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 43% coverage: 7:228/518 of query aligns to 5:230/375 of 2d62A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 45% coverage: 7:240/518 of query aligns to 1:236/238 of 6s8nB
>GFF1357 FitnessBrowser__psRCH2:GFF1357
MPDSQTARLQLCGITKQYPGCLANDRIDLSIQPGEIHALLGENGAGKSTLMKIIYGVTQP
DAGEIHWQGERVTMRDPAQARERGIGMVFQHFSLFETLSVAENIALALGAKAGTPKQLEP
KIREVSQRYGMPLEPQRLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEADEL
FVTLRRLAAEGCSILFISHKLNEVRALCQSATVLRAGRVSGECIPAECSDLELARLMVGD
AEGLEAEYPKSEGRAPFLRVERLSWHNADPFGVSLKEVDLEVRAGEIVGIAGVAGNGQDE
LLALLSGEQRLQAAQAMRIRFLGDDVAHLRPGARRRHGMAFVPAERLGHGAVPSMSLADN
GLLTAYQQTGMVEQGLIRRGRVRAFAEQVIQRFAVKTPDAQTPAASLSGGNLQKFILGRE
ILQQPKLLIAAHPTWGVDVGAAAAIHRALIELRDAGAAILVISEDLEELFQISDRIAALS
DGRLSPQRATASTCPVEVGRWMAGQFDTSDTPVSTSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory