Comparing GFF1360 FitnessBrowser__WCS417:GFF1360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
33% identity, 77% coverage: 43:248/266 of query aligns to 177:383/401 of 1fc4A
Sites not aligning to the query:
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
33% identity, 77% coverage: 43:248/266 of query aligns to 174:380/398 of P0AB77
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
30% identity, 90% coverage: 10:248/266 of query aligns to 135:380/398 of 7poaA
Sites not aligning to the query:
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
27% identity, 97% coverage: 4:262/266 of query aligns to 128:382/383 of 2g6wA
Sites not aligning to the query:
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 97% coverage: 4:262/266 of query aligns to 129:383/384 of P12998
Sites not aligning to the query:
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
28% identity, 72% coverage: 50:241/266 of query aligns to 179:372/396 of 3tqxA
Sites not aligning to the query:
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
30% identity, 83% coverage: 29:248/266 of query aligns to 178:401/419 of Q0P5L8
Sites not aligning to the query:
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
27% identity, 97% coverage: 4:262/266 of query aligns to 128:382/383 of 1djeA
Sites not aligning to the query:
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
27% identity, 97% coverage: 4:262/266 of query aligns to 128:382/383 of 1dj9A
Sites not aligning to the query:
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
28% identity, 77% coverage: 43:248/266 of query aligns to 176:382/400 of 7v58B
Sites not aligning to the query:
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8h29A
Sites not aligning to the query:
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8h21A
Sites not aligning to the query:
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8h20A
Sites not aligning to the query:
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8h1yA
Sites not aligning to the query:
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8h1qA
Sites not aligning to the query:
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
26% identity, 99% coverage: 1:264/266 of query aligns to 130:394/394 of 8guhA
Sites not aligning to the query:
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
29% identity, 75% coverage: 43:241/266 of query aligns to 176:375/399 of 7bxsA
Sites not aligning to the query:
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
29% identity, 75% coverage: 43:241/266 of query aligns to 176:375/399 of 7bxrA
Sites not aligning to the query:
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
29% identity, 75% coverage: 43:241/266 of query aligns to 176:375/399 of 7bxqA
Sites not aligning to the query:
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
26% identity, 98% coverage: 1:261/266 of query aligns to 130:391/392 of 3a2bA
Sites not aligning to the query:
>GFF1360 FitnessBrowser__WCS417:GFF1360
MVFDKHSHYSMNHIKASCADETDVTTAPHNDICFIEDLCKKRKHVAYIADGIYSMGGKAD
IDSLLYLKSRYGLFLYLDDSHALSAFGEKGRGFIRPHFQSLDDQTLIVASLGKSFGASGG
LVMFGSEKQKSLMYRYGGPSNWSQSLNSASIGAGLASIKIHQTNELPILQERLLANIQLF
DSLIETEQQGTRTAIRLIPCGEAEKANIIAAQLANSGFFTSAVFFPVVPRGNAAIRVTLR
ADMAHETILSFCSRLMSLIEENKIDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory