SitesBLAST
Comparing GFF1363 FitnessBrowser__psRCH2:GFF1363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 76% coverage: 29:230/267 of query aligns to 17:224/375 of 2d62A
1g291 Malk (see paper)
42% identity, 72% coverage: 29:221/267 of query aligns to 14:214/372 of 1g291
- binding magnesium ion: D69 (≠ S80), E71 (≠ V82), K72 (≠ D83), K79 (≠ R86), D80 (= D87)
- binding pyrophosphate 2-: S38 (= S53), G39 (= G54), C40 (= C55), G41 (= G56), K42 (= K57), T43 (≠ S58), T44 (= T59)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 81% coverage: 14:230/267 of query aligns to 3:213/384 of 8hplC
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 81% coverage: 14:230/267 of query aligns to 3:215/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F23), S38 (= S53), C40 (= C55), G41 (= G56), K42 (= K57), S43 (= S58), T44 (= T59), Q82 (= Q94), R129 (≠ K142), Q133 (≠ E146), S135 (= S148), G136 (= G149), G137 (= G150), Q159 (≠ E172), H192 (= H205)
- binding magnesium ion: S43 (= S58), Q82 (= Q94)
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 81% coverage: 14:230/267 of query aligns to 3:215/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F23), S38 (= S53), G39 (= G54), G41 (= G56), K42 (= K57), S43 (= S58), Q82 (= Q94), Q133 (≠ E146), G136 (= G149), G137 (= G150), Q138 (≠ M151), H192 (= H205)
- binding magnesium ion: S43 (= S58), Q82 (= Q94)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 75% coverage: 32:230/267 of query aligns to 40:244/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39
7aheC Opua inhibited inward facing (see paper)
39% identity, 75% coverage: 32:230/267 of query aligns to 40:244/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 84% coverage: 7:229/267 of query aligns to 11:228/378 of P69874
- C26 (≠ V22) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F23) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F46) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C55) mutation to T: Loss of ATPase activity and transport.
- L60 (= L61) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I77) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V134) mutation to M: Loss of ATPase activity and transport.
- D172 (= D171) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
7ahdC Opua (e190q) occluded (see paper)
39% identity, 75% coverage: 32:230/267 of query aligns to 40:244/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S53), G62 (= G54), G64 (= G56), K65 (= K57), S66 (= S58), T67 (= T59), Q111 (= Q94), K161 (≠ D145), Q162 (≠ E146), S164 (= S148), G166 (= G150), M167 (= M151), Q188 (≠ E172), H221 (= H205)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 13:214/374 of 2awnB
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 11:212/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S53), G36 (= G54), C37 (= C55), G38 (= G56), K39 (= K57), S40 (= S58), T41 (= T59), R126 (≠ K142), A130 (≠ E146), S132 (= S148), G134 (= G150), Q135 (≠ M151)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 76% coverage: 29:230/267 of query aligns to 14:215/371 of P68187
- A85 (≠ T97) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R118) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I124) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ G127) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E129) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ V134) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G150) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D171) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 13:214/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S53), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (= S58), T43 (= T59), Q81 (= Q94), R128 (≠ K142), A132 (≠ E146), S134 (= S148), G136 (= G150), Q137 (≠ M151), E158 (= E172), H191 (= H205)
- binding magnesium ion: S42 (= S58), Q81 (= Q94)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 13:214/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (= S58), T43 (= T59), R128 (≠ K142), S134 (= S148), Q137 (≠ M151)
- binding beryllium trifluoride ion: S37 (= S53), G38 (= G54), K41 (= K57), Q81 (= Q94), S134 (= S148), G136 (= G150), H191 (= H205)
- binding magnesium ion: S42 (= S58), Q81 (= Q94)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 13:214/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ A33), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (= S58), T43 (= T59), R128 (≠ K142), A132 (≠ E146), S134 (= S148), Q137 (≠ M151)
- binding tetrafluoroaluminate ion: S37 (= S53), G38 (= G54), K41 (= K57), Q81 (= Q94), S134 (= S148), G135 (= G149), G136 (= G150), E158 (= E172), H191 (= H205)
- binding magnesium ion: S42 (= S58), Q81 (= Q94)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 76% coverage: 29:230/267 of query aligns to 13:214/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ A33), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (= S58), T43 (= T59), R128 (≠ K142), A132 (≠ E146), S134 (= S148), Q137 (≠ M151)
- binding magnesium ion: S42 (= S58), Q81 (= Q94)
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 81% coverage: 14:228/267 of query aligns to 2:224/232 of 1f3oA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 78% coverage: 14:220/267 of query aligns to 4:214/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 78% coverage: 14:220/267 of query aligns to 4:214/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 78% coverage: 14:220/267 of query aligns to 4:214/353 of 1oxuA
Query Sequence
>GFF1363 FitnessBrowser__psRCH2:GFF1363
MNAAALPATPRPNISFDRVSQVFTSSDGSEVVALDNASFDIGRHEFIAVLGPSGCGKSTL
LRILAGLVRPTHGQVSIYGSPVDGPRDEIGIVFQRPTLLPWLNIRDNLTFPMRHKYGRVT
AQEITRGEELLELVGLKEFGNKRPDELSGGMQQRAAIARALLHDPEILLMDEPFSALDAL
TRDELSLELLNIWTQRPKTVLFITHSIPEALLLADRILVMSARPGRVQEIIDVDLPRPRS
METLTEPRFNELANHIRRKVFSRHADH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory