Comparing GFF1381 FitnessBrowser__Marino:GFF1381 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 46% coverage: 46:236/414 of query aligns to 90:293/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 49% coverage: 8:208/414 of query aligns to 52:234/444 of Q8NLB7
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
29% identity, 35% coverage: 60:205/414 of query aligns to 78:208/452 of Q5EXK5
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
28% identity, 29% coverage: 54:173/414 of query aligns to 162:264/556 of O08966
Sites not aligning to the query:
>GFF1381 FitnessBrowser__Marino:GFF1381
MAGFIGNVVEWYDFAVYGYLAGVIAPVFFSSANPTAALIGTYGIFAAGFIMRPLGAAVFG
WFGDRYGRARTMQISVMLMALPTLLLGMLPSYQQAGLLAPVLLVLIRLLQGLSVGGEFSS
SATYLVETAPDGKRGLTGSWANIGSMTGSLLGVAAAALVTNTLDEQTLSDWGWRLPFLGG
AILGIAAIAIRRNLHNSERFSQHHENRDETSPLLQAFTTNRRETLLALAFASSYGTCYYI
VFVYLPEWLSAQELLSRGTALLINTGMMLLVIPAMPLFAIVGDRWLRRRSWIAISLFLLT
VVAWPLHAWMLSSGGSLYVVVLAHALVFLLLAIPLGSAPALFVEMFPESDRLSGYSVAFN
LGLGVFGGLTPMIATSLIATTGVVTAPAMYLAVTAFIAVLALIAMPDRSREPLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory