Comparing GFF1384 FitnessBrowser__Phaeo:GFF1384 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
47% identity, 100% coverage: 1:477/478 of query aligns to 1:479/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
45% identity, 100% coverage: 1:477/478 of query aligns to 1:471/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 95% coverage: 3:457/478 of query aligns to 5:462/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 95% coverage: 3:457/478 of query aligns to 6:464/492 of 3ll3A
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
30% identity, 92% coverage: 1:438/478 of query aligns to 5:475/506 of 3i8bA
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
28% identity, 89% coverage: 5:431/478 of query aligns to 9:447/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 91% coverage: 3:435/478 of query aligns to 2:435/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
26% identity, 91% coverage: 3:435/478 of query aligns to 8:451/501 of O34154
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
25% identity, 96% coverage: 3:462/478 of query aligns to 7:477/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
25% identity, 96% coverage: 3:462/478 of query aligns to 6:476/498 of Q5HGD2
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
26% identity, 90% coverage: 3:431/478 of query aligns to 6:447/497 of O86033
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 91% coverage: 3:435/478 of query aligns to 6:450/496 of P18157
3h3nX Glycerol kinase h232r with glycerol (see paper)
26% identity, 91% coverage: 3:435/478 of query aligns to 7:451/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
26% identity, 91% coverage: 3:435/478 of query aligns to 8:452/506 of O34153
6zq4F Crystal structure of chaetomium thermophilum glycerol kinase in complex with substrate in p1 space group (see paper)
28% identity, 86% coverage: 5:417/478 of query aligns to 7:444/512 of 6zq4F
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
24% identity, 92% coverage: 3:442/478 of query aligns to 5:461/501 of 2w40A
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
24% identity, 92% coverage: 3:442/478 of query aligns to 11:467/507 of 2w41B
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 91% coverage: 3:435/478 of query aligns to 4:441/489 of 1gldG
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 91% coverage: 3:435/478 of query aligns to 4:441/489 of 1glcG
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
24% identity, 91% coverage: 3:435/478 of query aligns to 4:441/489 of 1glbG
>GFF1384 FitnessBrowser__Phaeo:GFF1384
MYLGIDLGTSGLRALMTDAAGKPVASAEAQYDVQTPHPGWSEQDPGDWITALDQAMAQLQ
GSPGYSDICGIAVAGHMHGAVLLDGSDQVLRPCILWNDTRSAAEAAELDAAEKVRDLSGN
IVFPGFTAPKLLWVQRHEPEIFANTAKVLLPAAYLNLHLTGRHVADMSDSAGTSWLDVGA
RDWSEWLLEAGHMRRDQMPDLVEGSAAAGTLRPELAVRWGLTGPVTIAGGAGDNAAAACG
TGVMAPGQGFVSLGTSGVVLTARDGFRPDPATAVHTFCHAIPDRWYQMGVMLSATDCMNW
LGRITGQSPADLTAGLGEELQPPGPVTFMPYLSGERTPHNSASLRGGFQGLSIATTAEDL
ARAVMEGVCYGLRDCLEALRKTGAEIDSCLVIGGGSKSAYWVKLLATILDLPLQLPKDGE
FGAALGAARLARLAVTGDDPADVLTAPESAMTVAPDPLLRDGYEAGYAAFRRRGAELT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory