SitesBLAST
Comparing GFF1391 FitnessBrowser__psRCH2:GFF1391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
44% identity, 98% coverage: 6:358/362 of query aligns to 1:347/347 of 6ie0B
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
35% identity, 90% coverage: 11:337/362 of query aligns to 13:333/357 of Q00796
- C45 (= C44) binding
- H70 (= H77) binding
- E71 (= E78) binding
- R110 (≠ Q117) to P: in HMNR8; results in protein aggregation
- H135 (≠ V141) to R: in HMNR8; results in protein aggregation
- A153 (= A159) to D: in HMNR8; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I190) binding
- D204 (≠ E210) binding
- R209 (= R215) binding
- Q239 (≠ G245) to L: in dbSNP:rs1042079
- N269 (≠ R273) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGI 277:279) binding
- VFR 297:299 (≠ SLA 301:303) binding
- V322 (≠ I326) to I: in HMNR8; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
35% identity, 90% coverage: 11:337/362 of query aligns to 12:332/356 of 1pl6A
- active site: C44 (= C44), G45 (= G45), S46 (= S46), H49 (= H49), H69 (= H77), E70 (= E78), R99 (≠ C107), D102 (≠ C110), C105 (= C113), S113 (≠ C121), F117 (≠ A125), P156 (= P163), G160 (= G167)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C44), S46 (= S46), I56 (≠ V56), F59 (= F57), H69 (= H77), E155 (= E162), L274 (≠ I279), F297 (≠ L302)
- binding nicotinamide-adenine-dinucleotide: G181 (= G188), P182 (≠ T189), I183 (= I190), D203 (≠ E210), L204 (≠ M211), R208 (= R215), C249 (= C254), T250 (≠ I255), V272 (= V277), G273 (= G278), L274 (≠ I279), F297 (≠ L302), R298 (≠ A303)
- binding zinc ion: C44 (= C44), H69 (= H77)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
33% identity, 98% coverage: 2:356/362 of query aligns to 3:344/347 of 5vm2A
- active site: C39 (= C44), G40 (= G45), S41 (= S46), H44 (= H49), H65 (= H77), E66 (= E78), C95 (= C107), C98 (= C110), C101 (= C113), C109 (= C121), D113 (≠ A125), P153 (= P163), G157 (= G167), K340 (= K352)
- binding magnesium ion: H65 (= H77), E66 (= E78), E152 (= E162)
- binding zinc ion: C95 (= C107), C98 (= C110), C101 (= C113), C109 (= C121)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
32% identity, 96% coverage: 9:356/362 of query aligns to 4:345/348 of 1e3jA
- active site: C38 (= C44), G39 (= G45), S40 (= S46), H43 (= H49), H63 (= H77), E64 (= E78), C93 (= C107), C96 (= C110), C99 (= C113), C107 (= C121), T111 (≠ A125), P150 (= P163), G154 (= G167), K341 (= K352)
- binding phosphate ion: A174 (= A187), A196 (= A214), R197 (= R215), S198 (≠ K216), R201 (≠ A219)
- binding zinc ion: C38 (= C44), H63 (= H77), E64 (= E78), C93 (= C107), C96 (= C110), C99 (= C113), C107 (= C121)
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
35% identity, 90% coverage: 11:337/362 of query aligns to 7:327/351 of 3qe3A
- active site: C39 (= C44), G40 (= G45), S41 (= S46), H44 (= H49), H64 (= H77), E65 (= E78), R94 (≠ C107), D97 (≠ C110), C100 (= C113), S108 (≠ C121), F112 (≠ A125), P151 (= P163), G155 (= G167)
- binding glycerol: Y45 (≠ E50), F54 (= F57), T116 (≠ L129), R293 (≠ A303)
- binding zinc ion: C39 (= C44), H64 (= H77), E65 (= E78)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
35% identity, 90% coverage: 11:337/362 of query aligns to 11:330/354 of P07846
- C43 (= C44) binding
- Y49 (= Y51) binding
- H67 (= H77) binding
- E68 (= E78) binding
- E153 (= E162) binding
- R296 (≠ A303) binding
- Y297 (= Y304) binding
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
33% identity, 90% coverage: 11:337/362 of query aligns to 13:333/357 of P27867
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
34% identity, 88% coverage: 22:341/362 of query aligns to 23:333/348 of O58389
- C42 (= C44) binding
- T44 (≠ S46) mutation to A: Total loss of enzymatic activity.
- H67 (= H77) binding
- E68 (= E78) binding
- C97 (= C107) binding
- C100 (= C110) binding
- C103 (= C113) binding
- C111 (= C121) binding
- E152 (= E162) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I190) binding
- E199 (= E210) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R215) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGI 277:279) binding
- IT 291:292 (≠ LA 302:303) binding
- R294 (vs. gap) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
34% identity, 88% coverage: 22:341/362 of query aligns to 21:331/346 of 2dfvA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H65 (= H77), E66 (= E78), C95 (= C107), C98 (= C110), C101 (= C113), C109 (= C121), K113 (≠ A125), P151 (= P163), A155 (≠ G167)
- binding nicotinamide-adenine-dinucleotide: G175 (= G188), P176 (≠ T189), L177 (≠ I190), E197 (= E210), P198 (≠ M211), R202 (= R215), F241 (≠ C254), S242 (≠ I255), A244 (≠ H257), L264 (≠ V277), G265 (= G278), L266 (≠ I279), I289 (≠ L302), T290 (≠ A303)
- binding zinc ion: C95 (= C107), C101 (= C113), C109 (= C121)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
34% identity, 91% coverage: 4:334/362 of query aligns to 1:322/342 of 4ejmA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H61 (= H77), E62 (= E78), C91 (= C107), C94 (= C110), C97 (= C113), C105 (= C121), R109 (≠ A125), P147 (= P163), C151 (≠ G167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G186), G172 (= G188), V173 (≠ T189), I174 (= I190), T194 (≠ E210), R195 (≠ M211), Q196 (≠ S212), K199 (≠ R215), C240 (= C254), E245 (≠ A259), T246 (= T260), L263 (≠ V277), V265 (≠ I279), I291 (≠ A303)
- binding zinc ion: C91 (= C107), C94 (= C110), C97 (= C113), C105 (= C121)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
34% identity, 91% coverage: 4:334/362 of query aligns to 1:322/343 of 4ej6A
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H61 (= H77), E62 (= E78), C91 (= C107), C94 (= C110), C97 (= C113), C105 (= C121), R109 (≠ A125), P147 (= P163), C151 (≠ G167)
- binding zinc ion: C91 (= C107), C94 (= C110), C97 (= C113), C105 (= C121)
Sites not aligning to the query:
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
32% identity, 93% coverage: 4:341/362 of query aligns to 4:331/347 of 3gfbA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H65 (= H77), E66 (= E78), C95 (= C107), C98 (= C110), C101 (= C113), C109 (= C121), K113 (≠ A125), P151 (= P163), A155 (≠ G167)
- binding nicotinamide-adenine-dinucleotide: G173 (= G186), G175 (= G188), P176 (≠ T189), L177 (≠ I190), S196 (≠ L209), E197 (= E210), P198 (≠ M211), R202 (= R215), F241 (≠ C254), S242 (≠ I255), A244 (≠ H257), L264 (≠ V277), G265 (= G278), L266 (≠ I279), I289 (= I299), T290 (≠ G300)
Sites not aligning to the query:
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
32% identity, 93% coverage: 4:341/362 of query aligns to 6:333/350 of Q5JI69
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
32% identity, 90% coverage: 11:337/362 of query aligns to 7:338/357 of 7y9pA
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
30% identity, 95% coverage: 11:353/362 of query aligns to 22:368/386 of A2QAC0
- M70 (≠ L66) mutation to F: Abolishes enzyme activity.
- DI 213:214 (≠ EM 210:211) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ L302) mutation to F: Increases affinity for D-sorbitol.
- A359 (= A344) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
31% identity, 94% coverage: 16:355/362 of query aligns to 11:346/347 of 2eerB
- active site: C38 (= C44), H39 (≠ G45), S40 (= S46), H43 (= H49), H68 (= H77), E69 (= E78), E98 (≠ C107), C101 (= C110), C104 (= C113), C112 (= C121), R116 (≠ A125), C154 (≠ E162), T158 (≠ V166), R342 (≠ V351)
- binding nicotinamide-adenine-dinucleotide: C38 (= C44), H39 (≠ G45), S40 (= S46), H43 (= H49), C154 (≠ E162), T158 (≠ V166), G178 (= G186), G181 (= G188), G182 (≠ T189), L183 (≠ I190), D203 (≠ E210), V204 (≠ M211), R205 (≠ S212), L247 (≠ C254), N248 (≠ I255), V270 (= V277), G271 (= G278), L272 (≠ I279), F273 (= F280), L295 (= L302), V296 (≠ A303), R342 (≠ V351)
- binding zinc ion: E98 (≠ C107), C101 (= C110), C104 (= C113), C112 (= C121)
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
32% identity, 90% coverage: 30:355/362 of query aligns to 52:373/377 of Q96V44
- DI 224:225 (≠ EM 210:211) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (= A344) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
32% identity, 94% coverage: 18:359/362 of query aligns to 13:343/343 of 2ejvA
- active site: C38 (= C44), G39 (= G45), T40 (≠ S46), H43 (= H49), H63 (= H77), E64 (= E78), C93 (= C107), C96 (= C110), C99 (= C113), C107 (= C121), Q111 (≠ A125), P149 (= P163), A153 (≠ G167), K336 (= K352)
- binding nicotinamide-adenine-dinucleotide: G172 (= G186), G174 (= G188), P175 (≠ T189), I176 (= I190), S195 (≠ L209), D196 (≠ E210), P197 (≠ M211), R201 (= R215), F238 (≠ C254), S239 (≠ I255), N241 (≠ H257), A244 (≠ T260), L261 (≠ V277), G262 (= G278), I263 (= I279)
- binding zinc ion: C38 (= C44), H63 (= H77), E64 (= E78), C96 (= C110), C99 (= C113), C107 (= C121)
2dq4A Crystal structure of threonine 3-dehydrogenase
32% identity, 94% coverage: 18:359/362 of query aligns to 13:343/343 of 2dq4A
- active site: C38 (= C44), G39 (= G45), T40 (≠ S46), H43 (= H49), H63 (= H77), E64 (= E78), C93 (= C107), C96 (= C110), C99 (= C113), C107 (= C121), Q111 (≠ A125), P149 (= P163), A153 (≠ G167), K336 (= K352)
- binding zinc ion: C38 (= C44), H63 (= H77), E64 (= E78), C93 (= C107), C96 (= C110), C107 (= C121)
Query Sequence
>GFF1391 FitnessBrowser__psRCH2:GFF1391
MNSQATMTAAVWHGRKDIRLEQVPLPGAPQPGWVQIRVHWCGICGSDLHEYLAGPVFIPV
DAPHPLTGIKGQCILGHEFCGEIVAIGEGVEGYAPGDKVAADACQHCGQCRFCKTGQYNL
CEQLAFTGLMNNGAFAEFVNVPAELLYRLPEGFPLEAGALIEPLAVGMHAVKKAGSLLGE
TVVVVGAGTIGLCTIMCAKAAGAGQVIALEMSAARKAKALEVGANWVIDPSECDAIAEIK
ALTGGYGAGVSFECIGHKATAKLAIDVIRKAGRCVMVGIFEEPSEFNFFEIVATEKQVIG
SLAYAGEFADVIALIDDGRIDVTPLITGRIGLDNILEQGFEELANHKDRNVKIIVSPGAL
AG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory