SitesBLAST
Comparing GFF1393 FitnessBrowser__Phaeo:GFF1393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
46% identity, 96% coverage: 6:364/375 of query aligns to 1:351/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
45% identity, 96% coverage: 6:364/375 of query aligns to 2:350/360 of 3okfA
- active site: R120 (= R127), K142 (= K149), E184 (= E191), K226 (= K233), R238 (= R247), N242 (= N251), H245 (= H254), H249 (= H258), H262 (= H272)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D49), L48 (≠ H55), D71 (≠ P78), E73 (= E80), K76 (= K83), G104 (= G111), G105 (= G112), V106 (= V113), D109 (= D116), T129 (= T136), T130 (≠ S137), L132 (= L139), D136 (= D143), T172 (= T179), L173 (= L180), E177 (≠ D184)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
47% identity, 94% coverage: 8:358/375 of query aligns to 3:339/355 of 5eksA
- active site: R120 (= R127), K142 (= K149), E184 (= E191), K226 (= K233), R237 (= R247), N241 (= N251), H244 (= H254), H248 (= H258), H261 (= H272)
- binding magnesium ion: E184 (= E191), H244 (= H254), H261 (= H272)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D49), V45 (= V52), D71 (≠ P78), E73 (= E80), K76 (= K83), G104 (= G111), G105 (= G112), V106 (= V113), D109 (= D116), T129 (= T136), T130 (≠ S137), D136 (= D143), S137 (= S144), K142 (= K149), T172 (= T179), L173 (= L180), E177 (≠ D184)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
44% identity, 96% coverage: 10:369/375 of query aligns to 84:440/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
44% identity, 96% coverage: 10:369/375 of query aligns to 4:360/365 of 3zokA
- active site: R122 (= R127), K144 (= K149), E186 (= E191), K228 (= K233), E238 (= E243), R242 (= R247), N246 (= N251), H249 (= H254), H253 (= H258), H266 (= H272)
- binding glycine: K144 (= K149), K228 (= K233), R242 (= R247)
- binding nicotinamide-adenine-dinucleotide: T44 (= T51), V45 (= V52), D73 (≠ P78), E75 (= E80), K78 (= K83), G106 (= G111), G107 (= G112), V108 (= V113), D111 (= D116), T131 (= T136), T132 (≠ S137), M134 (≠ L139), D138 (= D143), S139 (= S144), K144 (= K149), K153 (= K158), T174 (= T179), L175 (= L180), E179 (≠ D184), H266 (= H272)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
43% identity, 95% coverage: 8:364/375 of query aligns to 3:354/363 of 6llaB
- active site: R121 (= R127), K143 (= K149), E185 (= E191), K227 (= K233), E237 (= E243), R242 (= R247), N246 (= N251), H249 (= H254), H253 (= H258), H266 (= H272)
- binding magnesium ion: E185 (= E191), H249 (= H254), H266 (= H272)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V52), D72 (≠ P78), E74 (= E80), K77 (= K83), G105 (= G111), G106 (= G112), V107 (= V113), D110 (= D116), T130 (= T136), T131 (≠ S137), L133 (= L139), D137 (= D143), K143 (= K149), T173 (= T179), L174 (= L180), E178 (≠ D184)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
43% identity, 95% coverage: 8:364/375 of query aligns to 3:350/357 of 6lk2A
- active site: R121 (= R127), K143 (= K149), E185 (= E191), K227 (= K233), R238 (= R247), N242 (= N251), H245 (= H254), H249 (= H258), H262 (= H272)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D143), E185 (= E191), K227 (= K233), R238 (= R247), N242 (= N251), H245 (= H254), T246 (= T255), H249 (= H258), H262 (= H272)
- binding magnesium ion: E185 (= E191), H245 (= H254), H262 (= H272)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V52), D72 (≠ P78), E74 (= E80), K77 (= K83), G105 (= G111), G106 (= G112), V107 (= V113), D110 (= D116), T130 (= T136), T131 (≠ S137), L133 (= L139), D137 (= D143), S138 (= S144), C170 (≠ L176), T173 (= T179), L174 (= L180), P175 (≠ T181), E178 (≠ D184)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 96% coverage: 8:368/375 of query aligns to 2:339/343 of P56081
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
39% identity, 89% coverage: 18:351/375 of query aligns to 14:339/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
39% identity, 89% coverage: 18:351/375 of query aligns to 17:334/354 of 5hvnA
- active site: R123 (= R127), K145 (= K149), E187 (= E191), K228 (= K233), R239 (= R247), N243 (= N251), H246 (= H254), H250 (= H258), H263 (= H272)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D49), L51 (≠ H55), D73 (≠ P78), E75 (= E80), K78 (= K83), G107 (= G111), G108 (= G112), V109 (= V113), D112 (= D116), T132 (= T136), T133 (≠ S137), L135 (= L139), D139 (= D143), K145 (= K149), F172 (≠ L176), T175 (= T179), L176 (= L180), E180 (≠ D184)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
36% identity, 95% coverage: 12:368/375 of query aligns to 3:304/308 of 3clhA
- active site: R107 (= R127), K129 (= K149), E171 (= E191), K207 (= K233), R212 (= R247), N216 (= N251), H219 (= H254), H223 (= H258), H236 (= H272)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ T51), V34 (= V52), H38 (= H56), S58 (≠ P78), E60 (= E80), K63 (= K83), G91 (= G111), G92 (= G112), V93 (= V113), D96 (= D116), T116 (= T136), T117 (≠ S137), L119 (= L139), D123 (= D143), A124 (≠ S144), K129 (= K149), N139 (= N159), T159 (= T179), L160 (= L180), E164 (≠ D184)
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
38% identity, 82% coverage: 46:351/375 of query aligns to 36:330/353 of 1xagA
- active site: R115 (= R127), K136 (= K149), E178 (= E191), K221 (= K233), E231 (= E243), R235 (= R247), N239 (= N251), H242 (= H254), H246 (= H258), H256 (= H272)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K149), N146 (= N159), E178 (= E191), K221 (= K233), R235 (= R247), L238 (= L250), N239 (= N251), H242 (= H254), H246 (= H258), K314 (= K335)
- binding nicotinamide-adenine-dinucleotide: D39 (= D49), Y41 (≠ T51), V42 (= V52), Y45 (≠ H55), E68 (= E80), K71 (= K83), G99 (= G111), G100 (= G112), A101 (≠ V113), D104 (= D116), T124 (= T136), T125 (≠ S137), L127 (= L139), D130 (= D143), S131 (= S144), K136 (= K149), K145 (= K158), T166 (= T179), L167 (= L180), Q171 (≠ D184), H256 (= H272)
- binding zinc ion: E178 (= E191), H242 (= H254), H256 (= H272)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
37% identity, 83% coverage: 46:355/375 of query aligns to 36:334/354 of Q6GGU4
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
36% identity, 82% coverage: 46:354/375 of query aligns to 39:368/1555 of 6hqvA
- active site: R123 (= R127), K145 (= K149), E187 (= E191), K243 (= K233), E253 (= E243), R257 (= R247), N261 (= N251), H264 (= H254), H268 (= H258), H280 (= H272)
- binding glutamic acid: D139 (= D143), K145 (= K149), E187 (= E191), K243 (= K233), R257 (= R247), H264 (= H254), H280 (= H272)
- binding nicotinamide-adenine-dinucleotide: D42 (= D49), N44 (≠ T51), L45 (≠ V52), E76 (= E80), K79 (= K83), G107 (= G111), G108 (= G112), V109 (= V113), D112 (= D116), T132 (= T136), T133 (≠ S137), L135 (= L139), D139 (= D143), S140 (= S144), K145 (= K149), K154 (= K158), T175 (= T179), L176 (= L180), P177 (≠ T181), E180 (≠ D184), H280 (= H272)
- binding zinc ion: E187 (= E191), H264 (= H254), H280 (= H272)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
38% identity, 85% coverage: 38:354/375 of query aligns to 48:368/385 of 6c5cA
- active site: R130 (= R127), K152 (= K149), E194 (= E191), K246 (= K233), E254 (= E241), R258 (= R247), N262 (= N251), H265 (= H254), H269 (= H258), H281 (= H272)
- binding nicotinamide-adenine-dinucleotide: M48 (= M38), E83 (= E80), K86 (= K83), G114 (= G111), G115 (= G112), V116 (= V113), D119 (= D116), T139 (= T136), T140 (≠ S137), D146 (= D143), S147 (= S144), F179 (≠ L176), T182 (= T179), L183 (= L180), Q187 (≠ D184)
Sites not aligning to the query:
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
40% identity, 75% coverage: 77:356/375 of query aligns to 75:367/381 of 1dqsA
- active site: R127 (= R127), K149 (= K149), E191 (= E191), K240 (= K233), E250 (= E243), R254 (= R247), N258 (= N251), H261 (= H254), H265 (= H258), H277 (= H272)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D143), K149 (= K149), N159 (= N159), E191 (= E191), K240 (= K233), R254 (= R247), L257 (= L250), N258 (= N251), H261 (= H254), H265 (= H258), H277 (= H272), K346 (= K335)
- binding nicotinamide-adenine-dinucleotide: E78 (= E80), K81 (= K83), G111 (= G111), G112 (= G112), V113 (= V113), D116 (= D116), T136 (= T136), T137 (≠ S137), L139 (= L139), D143 (= D143), S144 (= S144), K158 (= K158), T179 (= T179), P181 (≠ T181), E184 (≠ D184), H277 (= H272)
- binding zinc ion: E191 (= E191), H261 (= H254), H277 (= H272)
Sites not aligning to the query:
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
39% identity, 83% coverage: 41:352/375 of query aligns to 37:340/362 of P9WPX9
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
39% identity, 75% coverage: 77:356/375 of query aligns to 76:375/391 of 1nvbB
- active site: R128 (= R127), K150 (= K149), E192 (= E191), K248 (= K233), E258 (= E243), R262 (= R247), N266 (= N251), H269 (= H254), H273 (= H258), H285 (= H272)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D143), K150 (= K149), N160 (= N159), E192 (= E191), K248 (= K233), R262 (= R247), L265 (= L250), N266 (= N251), H269 (= H254), H273 (= H258), K354 (= K335)
- binding zinc ion: E192 (= E191), H269 (= H254), H285 (= H272)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
39% identity, 75% coverage: 77:356/375 of query aligns to 78:377/1583 of P07547
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
38% identity, 83% coverage: 41:352/375 of query aligns to 32:331/352 of 3qbeA
- active site: R117 (= R127), K139 (= K149), E181 (= E191), K223 (= K233), R233 (= R247), N237 (= N251), H240 (= H254), H244 (= H258), H256 (= H272)
- binding zinc ion: E181 (= E191), H240 (= H254), H256 (= H272)
Query Sequence
>GFF1393 FitnessBrowser__Phaeo:GFF1393
MEQAMLERSVHVALGERAYDVVIGPDLLADAGARLAPMLRRPKVAVLTDETVAAHHLEGL
RAGLASAGIEMDALALPPGESTKAWPQFSRAVEWLLEQKVERGDIVIAFGGGVIGDLAGF
AAAVLRRGVRFVQIPTSLLAQVDSSVGGKTGINAPQGKNLIGAFHQPSLVLADTALLGTL
TPRDFLAGYGEVVKYGLLGDAEFFEWLEAQGPALAAGDMAARVEAVTRSVQMKADIVVRD
ETEQGDRALLNLGHTFCHALEAATGYGDRLLHGEGVAIGCALAFELSARLGLCSQEDPSR
VRAHLKAMGMKTDLADIPGELPDAEALLALMGQDKKVVDGQLRFILARGIGQAFVTGDVP
QAAVLDVLRDALAQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory