Comparing GFF1393 FitnessBrowser__psRCH2:GFF1393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
30% identity, 96% coverage: 12:516/525 of query aligns to 5:532/537 of 7w2jD
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
30% identity, 96% coverage: 12:516/525 of query aligns to 8:535/540 of 8jejA
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
31% identity, 82% coverage: 86:518/525 of query aligns to 88:529/531 of 8grjB
Sites not aligning to the query:
7dveA Crystal structure of fad-dependent c-glycoside oxidase (see paper)
26% identity, 96% coverage: 12:516/525 of query aligns to 8:489/498 of 7dveA
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
26% identity, 55% coverage: 227:516/525 of query aligns to 204:449/458 of 7qfdA
Sites not aligning to the query:
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
28% identity, 55% coverage: 227:516/525 of query aligns to 220:483/494 of 7qf8A
Sites not aligning to the query:
B5WWZ8 Long-chain-alcohol oxidase FAO1; Long-chain fatty alcohol oxidase 1; EC 1.1.3.20 from Lotus japonicus (Lotus corniculatus var. japonicus) (see paper)
23% identity, 80% coverage: 90:509/525 of query aligns to 311:733/749 of B5WWZ8
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
33% identity, 25% coverage: 387:516/525 of query aligns to 316:448/457 of 7qvaA
Sites not aligning to the query:
>GFF1393 FitnessBrowser__psRCH2:GFF1393
MATFAQDDDGVVVIIGSGAGGGTLANALAKQKIRSVVLEAGKRHTLEDIENDEWAMFKKI
SWLDKRQAAGGWHLTENNPTLPAWIVKGVGGSTVHWAGIALRFRDFEFKMQSINGDIAGA
NLLDWPVTLEEMAPWYEKAEKHMGVTGPSTGMDYHPWHNSFKVLATGAKRVGYKEILSGP
MAINTEPYDDRAACQQLGFCMQGCKMGAKWSTLYTDIPRAEASGYCEVRPQSMVLRIEHD
AKGRANAVVYADASGTIQRQKARVVCVAGNSIESPRLLLNSASAMFPDGLANSSGQVGRN
YMTHTTAGIFAVMPKPVNMHRGTTCAGVISDESYNDPSRGFVGGYRLEILALGLPFLSAF
LDPTPKGWGKQFTSRMEKYNHMSGVWLCGEDLPLESNRITLHDSEKDQYGLPIPVVTKSD
HPMDAAMRKHGVAATARCYEAAGATDIIELPPYPASHNMGTNRMSAMARDGVVNKWGQSH
DIPNLFVSDGSQFTTSGGQNPTLTIVALALRQAEQIGRLLNERAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory