SitesBLAST
Comparing GFF1397 FitnessBrowser__Marino:GFF1397 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
58% identity, 58% coverage: 309:737/742 of query aligns to 5:432/440 of 3slhD
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N95 (= N398), R125 (= R428), D317 (= D621), E345 (= E649), H388 (= H693), R389 (= R694), T415 (= T720)
- binding glyphosate: K23 (= K327), G97 (= G400), T98 (= T401), R125 (= R428), Q171 (= Q475), D317 (= D621), E345 (= E649), R348 (= R652), H388 (= H693), R389 (= R694)
- binding shikimate-3-phosphate: S24 (= S328), R28 (= R332), S169 (= S473), Q171 (= Q475), R196 (= R500), D317 (= D621), K344 (= K648)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S328), R28 (= R332), T98 (= T401), Q171 (= Q475), R196 (= R500), D317 (= D621), K344 (= K648)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
58% identity, 58% coverage: 309:737/742 of query aligns to 3:430/438 of Q83E11
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
58% identity, 58% coverage: 309:737/742 of query aligns to 5:428/434 of 4egrA
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N95 (= N398), R125 (= R428), D313 (= D621), E341 (= E649), H384 (= H693), R385 (= R694), T411 (= T720)
- binding phosphoenolpyruvate: K23 (= K327), G97 (= G400), T98 (= T401), R125 (= R428), D313 (= D621), E341 (= E649), R344 (= R652), R385 (= R694)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
49% identity, 55% coverage: 319:727/742 of query aligns to 12:419/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
49% identity, 55% coverage: 319:727/742 of query aligns to 12:419/427 of 1rf6A
- active site: K20 (= K327), S21 (= S328), D47 (= D354), N90 (= N398), D115 (≠ A423), R120 (= R428), D312 (= D621), E340 (= E649), H384 (= H693), R385 (= R694), T412 (= T720)
- binding glyphosate: K20 (= K327), G92 (= G400), T93 (= T401), R120 (= R428), Q168 (= Q475), D312 (= D621), E340 (= E649), R343 (= R652), H384 (= H693), R385 (= R694)
- binding shikimate-3-phosphate: S21 (= S328), R25 (= R332), S166 (= S473), Q168 (= Q475), R193 (= R500), I311 (= I620), D312 (= D621), K339 (= K648)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
49% identity, 55% coverage: 319:727/742 of query aligns to 12:419/427 of 1rf4A
- active site: K20 (= K327), S21 (= S328), D47 (= D354), N90 (= N398), D115 (≠ A423), R120 (= R428), D312 (= D621), E340 (= E649), H384 (= H693), R385 (= R694), T412 (= T720)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K327), S21 (= S328), R25 (= R332), G92 (= G400), T93 (= T401), R120 (= R428), S166 (= S473), A167 (= A474), Q168 (= Q475), R193 (= R500), D312 (= D621), K339 (= K648), E340 (= E649), R343 (= R652), H384 (= H693), R385 (= R694)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
49% identity, 58% coverage: 303:736/742 of query aligns to 6:447/455 of Q9R4E4
- KS 28:29 (= KS 327:328) binding
- R33 (= R332) binding
- NAAT 98:101 (≠ NSGT 398:401) Phosphoenolpyruvate
- A100 (≠ G400) mutation to G: Confers resistance to glyphosate.
- R128 (= R428) binding
- K353 (= K648) binding
- R357 (= R652) binding
- R405 (= R694) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
49% identity, 58% coverage: 303:736/742 of query aligns to 1:442/445 of 2pqcA
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N93 (= N398), R123 (= R428), D321 (= D621), E349 (= E649), H399 (= H693), R400 (= R694), T426 (= T720)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K327), S24 (= S328), R28 (= R332), T96 (= T401), R123 (= R428), S168 (= S473), Q170 (= Q475), D321 (= D621), K348 (= K648), E349 (= E649), R352 (= R652), R400 (= R694)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
49% identity, 58% coverage: 303:736/742 of query aligns to 1:442/445 of 2pqbA
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N93 (= N398), R123 (= R428), D321 (= D621), E349 (= E649), H399 (= H693), R400 (= R694), T426 (= T720)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K327), S24 (= S328), R28 (= R332), A95 (≠ G400), T96 (= T401), R123 (= R428), S168 (= S473), Q170 (= Q475), D321 (= D621), K348 (= K648), E349 (= E649), R352 (= R652), R400 (= R694)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
49% identity, 58% coverage: 303:736/742 of query aligns to 1:442/445 of 2ggaA
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N93 (= N398), R123 (= R428), D321 (= D621), E349 (= E649), H399 (= H693), R400 (= R694), T426 (= T720)
- binding glyphosate: K23 (= K327), A94 (≠ S399), A95 (≠ G400), T96 (= T401), R123 (= R428), D321 (= D621), E349 (= E649), R352 (= R652), R400 (= R694)
- binding shikimate-3-phosphate: S24 (= S328), R28 (= R332), S168 (= S473), A169 (= A474), Q170 (= Q475), R195 (= R500), D321 (= D621), K348 (= K648)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
49% identity, 58% coverage: 303:736/742 of query aligns to 1:442/445 of 2gg6A
- active site: K23 (= K327), S24 (= S328), D50 (= D354), N93 (= N398), R123 (= R428), D321 (= D621), E349 (= E649), H399 (= H693), R400 (= R694), T426 (= T720)
- binding shikimate-3-phosphate: S24 (= S328), R28 (= R332), T96 (= T401), S168 (= S473), Q170 (= Q475), D321 (= D621), K348 (= K648)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
45% identity, 38% coverage: 8:286/742 of query aligns to 4:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), G13 (= G17), L14 (= L18), I15 (= I19), T36 (≠ D40), R37 (≠ H41), S38 (≠ R42), T41 (≠ E45), S71 (≠ A75), V72 (= V76), P73 (= P77), A76 (= A80), V97 (= V101), S99 (= S103), A125 (= A130), S130 (= S135), M234 (= M237)
- binding tyrosine: S99 (= S103), H122 (= H127), A125 (= A130), T127 (≠ S132), R226 (= R229)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
38% identity, 37% coverage: 9:286/742 of query aligns to 6:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G222), G219 (= G223)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L16), G14 (= G17), F15 (≠ L18), M16 (≠ I19), D37 (= D40), I38 (≠ H41), S42 (≠ E45), S73 (≠ A75), S74 (≠ V76), P75 (= P77), T78 (≠ A80), Q99 (≠ V101), S101 (= S103), G131 (= G136), M233 (= M237)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
38% identity, 37% coverage: 9:286/742 of query aligns to 14:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L16), G22 (= G17), F23 (≠ L18), M24 (≠ I19), D45 (= D40), I46 (≠ H41), S50 (≠ E45), S81 (≠ A75), S82 (≠ V76), P83 (= P77), V84 (= V78), T86 (≠ A80), Q107 (≠ V101), S109 (= S103), G134 (= G131), T135 (≠ S132)
- binding tyrosine: G225 (≠ A221), G226 (= G222)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
38% identity, 37% coverage: 9:286/742 of query aligns to 6:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A221), G218 (= G222), G219 (= G223)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L16), G14 (= G17), F15 (≠ L18), M16 (≠ I19), D37 (= D40), I38 (≠ H41), S42 (≠ E45), S73 (≠ A75), S74 (≠ V76), P75 (= P77), T78 (≠ A80), Q99 (≠ V101), S101 (= S103), A125 (= A130), G131 (= G136), M233 (= M237)
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
40% identity, 38% coverage: 9:287/742 of query aligns to 2:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G17), L11 (= L18), I12 (= I19), D32 (= D40), I33 (≠ H41), A67 (= A75), P69 (= P77), E72 (≠ A80), V94 (= V101), S96 (= S103), G128 (= G136)
- binding tyrosine: K126 (= K134)
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
40% identity, 38% coverage: 9:287/742 of query aligns to 10:288/373 of 5uyyA
Sites not aligning to the query:
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
29% identity, 57% coverage: 308:727/742 of query aligns to 3:419/426 of 3nvsA
- active site: K22 (= K327), S23 (= S328), D49 (= D354), N94 (= N398), P119 (≠ A423), R124 (= R428), H128 (≠ R432), Q135 (≠ A439), Y142 (≠ T446), E144 (= E448), A247 (≠ S543), A255 (≠ S551), D314 (= D621), E342 (= E649), H386 (= H693), R387 (= R694), K412 (≠ T720)
- binding glyphosate: K22 (= K327), G96 (= G400), R124 (= R428), Q172 (= Q475), D314 (= D621), E342 (= E649), R345 (= R652), H386 (= H693), R387 (= R694)
- binding magnesium ion: E123 (≠ G427), Q145 (≠ G449)
- binding shikimate-3-phosphate: K22 (= K327), S23 (= S328), R27 (= R332), T97 (= T401), S170 (= S473), S171 (≠ A474), Q172 (= Q475), S198 (≠ P496), Y201 (≠ T499), D314 (= D621), N337 (≠ E644), K341 (= K648)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S328), R27 (= R332), Q172 (= Q475), Y201 (≠ T499), D314 (= D621), K341 (= K648)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 57% coverage: 308:727/742 of query aligns to 3:419/426 of Q9KRB0
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
33% identity, 38% coverage: 9:288/742 of query aligns to 7:284/286 of 3b1fA
Query Sequence
>GFF1397 FitnessBrowser__Marino:GFF1397
MTSSEPLFKRVAVIGLGLIGGSLACAIRRKGLAVTVVGADHRTEELQLGKELGVIDQAAS
TVSDAVRGADLVVLAVPVRATRAVLEQIRPALEPDAILTDVGSTKSSFVADVEAVFGGLS
PLVIPGHPIAGSEKSGIRAANPELFANHKVILTPPDNVSQPHLARLKGLWEGCGATVLTM
SVAYHDEVLAATSHLPHLIAFSLVDTLAGEDENMDIFRYAAGGFRDFTRIAASDPVMWHD
IFLSNRDAVLRVIDHFTHDLEQLRTAIANQDSATLLRVFSRAKAAREHFSKMLSGQAYVT
NNSEKQVTFRLQPGGAITGDIRVPGDKSMSHRSIMLGALADGVTEVKGFLEGEDSLATLQ
AFRDMGVTIEGPDDGFVRIHGVGMHGLQAPRGPLYLGNSGTAMRLFAGLLAAQPFDSELT
GDASLSGRPMGRVADPLRAMGAVIDTAEGGRPPLKIRGGQKLSGIHYEMPVASAQVKSCL
LLAGLYAEGSTSVTEPAPTRDHTERMLAGFGYHVHRDGATASVSGGGKLTATNIDVPADI
SSSAFFLVAASIAPGSNLILRHVGMNPTRVGVINILNQMGANIEILDEREIGGEPVADLR
VRSAELQGIDIPEDQVPLAIDEFPVLFIAAACANGRTVLRGAEELRVKESDRIQVMADGL
AALGVETTVTPDGIIIDGGQTIGGGTVNSHGDHRIAMSFAVASLRAAGDITVNDCANVAT
SFPGFVELAQGTGINISAEGAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory