Comparing GFF1423 FitnessBrowser__WCS417:GFF1423 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 57% coverage: 124:372/435 of query aligns to 129:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 57% coverage: 124:372/435 of query aligns to 129:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 57% coverage: 124:372/435 of query aligns to 129:407/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 57% coverage: 124:372/435 of query aligns to 133:411/491 of P0AGF4
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
29% identity, 32% coverage: 60:200/435 of query aligns to 57:175/437 of 6rw3A
Sites not aligning to the query:
>GFF1423 FitnessBrowser__WCS417:GFF1423
MTSPTRPDSARSKVGAVFRVTSGNFLEQFDFFLFGFYATYIAAAFFPAANEFASLMMTFA
VFGAGFLMRPLGAIILGAYIDDVGRRKGLIVTLSIMASGTLLIVLVPSYHTIGLWAPLLV
LLGRLLQGFSAGAELGGVSVYLSEMATPGRKGFYTSWQSGSQQISIVVAAALGYGLNVWM
EPAVVADWGWRIPFAIGCVIIPFIFILRRSLQETEEFANRKHRPTMREVLATLVKNWTVV
IGGMLMVAMTTTAFYLITVYAPTFGKTVLQLSTSDALLVTLLVAVSNFIWLPIGGTLSDR
FGRKPVLIAMTVLTVLTAYPALSYVVNAPSFAHMLETLLWFSFLYGLYNGAMIPALTEIM
PVEVRVAGFSLAYSLATAIFGGFTPAISTWFIHITEDKASPAYWMMFAAACALCSTLALY
RRANARGQVMQGAAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory