Comparing GFF1423 FitnessBrowser__Phaeo:GFF1423 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
51% identity, 71% coverage: 20:108/125 of query aligns to 16:104/200 of 6j2lA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
41% identity, 86% coverage: 13:119/125 of query aligns to 10:119/213 of 7bgmA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
39% identity, 86% coverage: 13:120/125 of query aligns to 8:115/204 of 7bgnA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
48% identity, 71% coverage: 20:108/125 of query aligns to 15:97/185 of 6j2lB
Sites not aligning to the query:
>GFF1423 FitnessBrowser__Phaeo:GFF1423
MQKVFAMSFDPLSLKYNEAGLIPCIAQEEDSGEVLMMAWMNADAVMKTLESGRVTYWSRS
RQAFWIKGESSGHVQALVDLRVDCDRDCLLAVVRQSGPACHTNRRSCFYTAIRDGEEVEL
MQPMV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory