SitesBLAST
Comparing GFF1425 FitnessBrowser__WCS417:GFF1425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
34% identity, 95% coverage: 12:259/262 of query aligns to 7:255/258 of 3ak4A
- active site: G18 (= G23), S141 (= S145), L151 (≠ R155), Y154 (= Y158), K158 (= K162), E199 (≠ R203)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ V44), V60 (≠ A64), D61 (= D65), V62 (= V66), N88 (= N92), A89 (= A93), G90 (= G94), T139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), G185 (= G189), V187 (= V191), T189 (≠ G193), M191 (≠ R195)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
34% identity, 94% coverage: 15:259/262 of query aligns to 10:242/245 of 5t5qC
- active site: G18 (= G23), S140 (= S145), N150 (≠ R155), Y153 (= Y158), K157 (= K162)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A21), G17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ V44), D63 (= D65), A64 (≠ V66), S90 (≠ N92), I113 (= I116), Y153 (= Y158), K157 (= K162), P182 (= P188), I185 (≠ V191), T187 (≠ G193), M189 (≠ R195)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
34% identity, 94% coverage: 12:257/262 of query aligns to 4:250/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), T13 (≠ A21), S14 (≠ A22), G15 (= G23), I16 (= I24), G35 (vs. gap), F36 (vs. gap), L60 (≠ V66), N86 (= N92), G88 (= G94), I89 (= I95), A137 (= A144), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), V184 (= V191), T186 (≠ G193)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 93% coverage: 16:259/262 of query aligns to 11:242/244 of 4nbuB
- active site: G18 (= G23), N111 (= N117), S139 (= S145), Q149 (≠ R155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (≠ P98), K98 (≠ A104), S139 (= S145), N146 (≠ Y152), V147 (≠ A153), Q149 (≠ R155), Y152 (= Y158), F184 (≠ I190), M189 (≠ R195), K200 (≠ E217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), F39 (≠ V44), V59 (≠ A64), D60 (= D65), V61 (= V66), N87 (= N92), A88 (= A93), G89 (= G94), I90 (= I95), T137 (≠ I143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ I190), T185 (≠ V191), T187 (≠ G193), M189 (≠ R195)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
34% identity, 97% coverage: 4:257/262 of query aligns to 1:252/257 of 6pejA
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
36% identity, 92% coverage: 16:257/262 of query aligns to 9:248/254 of 3toxA
- active site: G16 (= G23), S142 (= S145), V153 (≠ R155), Y156 (= Y158), K160 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), S15 (≠ A22), G16 (= G23), I17 (= I24), A36 (≠ D43), R37 (≠ V44), N38 (≠ S45), V63 (= V66), N89 (= N92), A90 (= A93), G91 (= G94), T140 (≠ I143), S142 (= S145), Y156 (= Y158), K160 (= K162), P186 (= P188), G188 (≠ I190), T189 (≠ V191), T191 (≠ G193)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
31% identity, 92% coverage: 16:257/262 of query aligns to 9:235/239 of 4nbtA
- active site: G16 (= G23), S132 (= S145), Y145 (= Y158), K149 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), K15 (≠ A22), G16 (= G23), L17 (≠ I24), D36 (= D43), L37 (≠ V44), L52 (≠ A64), N53 (≠ D65), V54 (= V66), N80 (= N92), A81 (= A93), G82 (= G94), I130 (= I143), S132 (= S145), Y145 (= Y158), K149 (= K162), P177 (= P188), G178 (= G189), I180 (≠ V191), T182 (≠ D197)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
33% identity, 94% coverage: 16:261/262 of query aligns to 6:255/256 of 1gegE
- active site: G13 (= G23), S139 (= S145), Y152 (= Y158), K156 (= K162), V197 (≠ R203)
- binding alpha-D-glucopyranose: R63 (≠ A69), D64 (≠ A70), F67 (≠ E73), E123 (≠ P130)
- binding nicotinamide-adenine-dinucleotide: G9 (= G19), Q12 (≠ A22), I14 (= I24), D33 (= D43), Y34 (≠ V44), V58 (≠ A64), D59 (= D65), V60 (= V66), N86 (= N92), A87 (= A93), I109 (= I116), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), V185 (= V191), T187 (≠ G193), M189 (≠ R195)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
34% identity, 94% coverage: 12:257/262 of query aligns to 4:250/255 of 2q2qD
- active site: G15 (= G23), S138 (= S145), Y151 (= Y158), K155 (= K162), R196 (= R203)
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), T13 (≠ A21), S14 (≠ A22), G15 (= G23), I16 (= I24), F36 (≠ V44), D59 (= D65), L60 (≠ V66), N86 (= N92), G88 (= G94), L109 (≠ I116), I136 (= I143), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), W183 (≠ I190), V184 (= V191), T186 (≠ G193), L188 (≠ R195), V189 (≠ M196)
4b79A The aeropath project and pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery. (see paper)
35% identity, 95% coverage: 10:257/262 of query aligns to 8:231/236 of 4b79A
- active site: G21 (= G23), S133 (= S145), R143 (= R155), Y146 (= Y158), K150 (= K162)
- binding nicotinamide-adenine-dinucleotide: G17 (= G19), S19 (≠ A21), S20 (≠ A22), G21 (= G23), I22 (= I24), L42 (≠ V44), L60 (≠ A64), D61 (= D65), I62 (≠ V66), N84 (= N92), G86 (= G94), L105 (≠ I116), I131 (= I143), Y146 (= Y158), K150 (= K162), P176 (= P188), G177 (= G189), I179 (≠ V191), T181 (≠ G193)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
33% identity, 94% coverage: 16:261/262 of query aligns to 6:255/256 of Q48436
- 6:33 (vs. 16:43, 32% identical) binding
- D59 (= D65) binding
- K156 (= K162) binding
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
29% identity, 92% coverage: 16:257/262 of query aligns to 11:256/261 of 6zzsD
- active site: G18 (= G23), S143 (= S145), Y156 (= Y158)
- binding nicotinamide-adenine-dinucleotide: G14 (= G19), S17 (≠ A22), I19 (= I24), D38 (= D43), M39 (≠ V44), D64 (= D65), V65 (= V66), N91 (= N92), A92 (= A93), G93 (= G94), M141 (≠ I143), A142 (= A144), S143 (= S145), Y156 (= Y158), K160 (= K162), P186 (= P188), G187 (= G189), V189 (= V191), T191 (≠ G193), L193 (≠ R195)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A96), S143 (= S145), N145 (≠ A147), K153 (≠ R155), Y156 (= Y158), Q197 (≠ V199)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
29% identity, 92% coverage: 16:257/262 of query aligns to 10:255/260 of 6zzqA
- active site: G17 (= G23), S142 (= S145), Y155 (= Y158)
- binding acetoacetic acid: Q94 (≠ A96), S142 (= S145), K152 (≠ R155), Y155 (= Y158), Q196 (≠ V199)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), S16 (≠ A22), G17 (= G23), I18 (= I24), D37 (= D43), M38 (≠ V44), D63 (= D65), V64 (= V66), N90 (= N92), A91 (= A93), G92 (= G94), M140 (≠ I143), A141 (= A144), S142 (= S145), Y155 (= Y158), K159 (= K162), Y187 (≠ I190), V188 (= V191), T190 (≠ G193)
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
33% identity, 94% coverage: 12:257/262 of query aligns to 8:251/259 of 2ae2A
- active site: G19 (= G23), S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G19), S17 (≠ A21), R18 (≠ A22), G19 (= G23), I20 (= I24), S39 (≠ D43), R40 (≠ V44), C64 (≠ A64), L66 (≠ V66), N93 (= N92), G95 (= G94), I116 (= I116), I143 (= I143), S145 (= S145), Y158 (= Y158), K162 (= K162), P188 (= P188), G189 (= G189), V190 (≠ I190), I191 (≠ V191), T193 (≠ G193), S194 (≠ P194), L195 (≠ R195), V196 (≠ M196)
- binding pseudotropine: S145 (= S145), E155 (≠ R155), Y158 (= Y158), L195 (≠ R195)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
33% identity, 94% coverage: 12:257/262 of query aligns to 8:251/259 of 1ipfA
- active site: G19 (= G23), S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G19), R18 (≠ A22), G19 (= G23), I20 (= I24), S39 (≠ D43), R40 (≠ V44), C64 (≠ A64), D65 (= D65), L66 (≠ V66), N93 (= N92), S145 (= S145), Y158 (= Y158), K162 (= K162), P188 (= P188), V190 (≠ I190), I191 (≠ V191), T193 (≠ G193), S194 (≠ P194), L195 (≠ R195), V196 (≠ M196)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (≠ A147), E155 (≠ R155), Y158 (= Y158)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
33% identity, 94% coverage: 12:257/262 of query aligns to 8:251/259 of 1ipeA
- active site: G19 (= G23), S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G19), S17 (≠ A21), R18 (≠ A22), G19 (= G23), I20 (= I24), S39 (≠ D43), R40 (≠ V44), C64 (≠ A64), D65 (= D65), L66 (≠ V66), N93 (= N92), I116 (= I116), S145 (= S145), Y158 (= Y158), K162 (= K162), P188 (= P188), I191 (≠ V191), T193 (≠ G193), S194 (≠ P194), L195 (≠ R195), V196 (≠ M196)
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
33% identity, 94% coverage: 12:257/262 of query aligns to 9:252/260 of P50163
- 18:41 (vs. 21:44, 29% identical) binding
- S146 (= S145) binding
- IATSL 192:196 (≠ VEGPR 191:195) binding
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
34% identity, 92% coverage: 16:257/262 of query aligns to 11:252/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G19), M17 (≠ A22), G18 (= G23), M19 (≠ I24), D38 (= D43), R39 (≠ V44), D63 (= D65), I64 (≠ V66), A90 (≠ N92), A91 (= A93), S142 (= S145), Y156 (= Y158), K160 (= K162), P186 (= P188), G187 (= G189), M189 (≠ V191), T191 (≠ G193), P192 (= P194), M193 (≠ R195)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
31% identity, 92% coverage: 16:257/262 of query aligns to 8:240/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), M16 (≠ I24), D35 (= D43), I36 (≠ V44), I62 (≠ V66), N88 (= N92), G90 (= G94), I138 (= I143), S140 (= S145), Y152 (= Y158), K156 (= K162), I185 (≠ V191)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
31% identity, 92% coverage: 16:257/262 of query aligns to 9:241/248 of Q9KJF1
- S15 (≠ A22) binding
- D36 (= D43) binding
- D62 (= D65) binding
- I63 (≠ V66) binding
- N89 (= N92) binding
- Y153 (= Y158) binding
- K157 (= K162) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF1425 FitnessBrowser__WCS417:GFF1425
MSVLQRLQPYPGLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGTV
ATRADVSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTA
QYRFAHHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESD
IRVNALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFL
CSPAARNVTGQAISVDGNVEYL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory