Comparing GFF1426 FitnessBrowser__WCS417:GFF1426 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3e49A Crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution
70% identity, 99% coverage: 4:310/310 of query aligns to 1:307/307 of 3e49A
3e02A Crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution
56% identity, 100% coverage: 1:310/310 of query aligns to 1:310/310 of 3e02A
3lotD Crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution
54% identity, 100% coverage: 1:310/310 of query aligns to 1:313/313 of 3lotD
B0VHH0 3-keto-5-aminohexanoate cleavage enzyme; EC 2.3.1.247 from Cloacimonas acidaminovorans (strain Evry) (see paper)
35% identity, 96% coverage: 6:302/310 of query aligns to 3:274/276 of B0VHH0
2y7gA Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the product acetoacetate (see paper)
35% identity, 96% coverage: 4:302/310 of query aligns to 2:275/276 of 2y7gA
2y7fD Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the substrate 3- keto-5-aminohexanoate (see paper)
35% identity, 96% coverage: 4:302/310 of query aligns to 3:276/277 of 2y7fD
2y7fA Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the substrate 3- keto-5-aminohexanoate (see paper)
35% identity, 96% coverage: 4:302/310 of query aligns to 3:276/277 of 2y7fA
2y7dD Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from candidatus cloacamonas acidaminovorans (orthorombic form) (see paper)
35% identity, 96% coverage: 4:302/310 of query aligns to 4:277/278 of 2y7dD
3fa5A Crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution
31% identity, 96% coverage: 5:303/310 of query aligns to 2:274/276 of 3fa5A
3no5E Crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution
31% identity, 96% coverage: 4:302/310 of query aligns to 3:274/275 of 3no5E
3chvA Crystal structure of a prokaryotic domain of unknown function (duf849) member (spoa0042) from silicibacter pomeroyi dss-3 at 1.45 a resolution
31% identity, 96% coverage: 4:302/310 of query aligns to 2:273/279 of 3chvA
Sites not aligning to the query:
5zmyA Crystal structure of a cis-epoxysuccinate hydrolase producing d(-)- tartaric acids (see paper)
31% identity, 90% coverage: 23:302/310 of query aligns to 19:280/280 of 5zmyA
Sites not aligning to the query:
5zmuD Crystal structure of a cis-epoxysuccinate hydrolase producing d(-)- tartaric acids (see paper)
30% identity, 90% coverage: 23:302/310 of query aligns to 19:287/287 of 5zmuD
Sites not aligning to the query:
4nnbA Binary complex of obca with oxaloacetate (see paper)
26% identity, 95% coverage: 9:302/310 of query aligns to 141:482/484 of 4nnbA
4nnaA Apo structure of obca (see paper)
26% identity, 95% coverage: 9:302/310 of query aligns to 155:496/498 of 4nnaA
4nncA Ternary complex of obca with c4-coa adduct and oxalate (see paper)
26% identity, 95% coverage: 9:302/310 of query aligns to 142:483/483 of 4nncA
Sites not aligning to the query:
>GFF1426 FitnessBrowser__WCS417:GFF1426
MSKNRPVIITCAVTGAIHTPSMSPHLPITAQEIADAAIGAAEAGAAIVHLHARDPNDGRP
SQDPALFAEFLPQIKAASDVVINITTGGAPTMGVEERLQPVMQFKPELASLNMGSMNFGL
YEMLNRFTDFKHDWERPYLEESDDRIFRNTFRDITHILNACAENRTRFEIECYDIGHLYT
AAHFLERGLLKPPLFIQSVFGLRGGIGGHPEDLAHMRRTADRLFGSDYVWSILGAGRGQI
PLATMGLSMGSNARVGLEDSLWDGPGKLAASNADQVRRIRTVIEALGHRVATPDEAREIL
GLKGRDQVNF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory