Comparing GFF1428 FitnessBrowser__WCS417:GFF1428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 67% coverage: 15:307/440 of query aligns to 19:314/452 of Q5EXK5
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
21% identity, 93% coverage: 14:423/440 of query aligns to 12:417/430 of P0AA76
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
21% identity, 93% coverage: 14:423/440 of query aligns to 1:398/409 of 6e9nA
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
21% identity, 38% coverage: 10:177/440 of query aligns to 21:181/448 of Q51955
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 86% coverage: 22:400/440 of query aligns to 19:368/403 of P77589
>GFF1428 FitnessBrowser__WCS417:GFF1428
MATIKKASLRSIHRHSWVSLLVCWMIWILNAYDREIVLRLGPTISKHFDLSADQWGTVAT
VVMLALALLDIPGSMWSDRYGGGWKRARFQVPLVLGYTAISFLSGFKALSGNLATFIALR
VGVNLGAGWGEPVGVSNTAEWWPVERRGFALGAHHTGYPIGAMLSGIVASFVITVFGEEN
WRYVFYFAFVVALPLMIFWARYSTAERISALYVDIAAKGMTPPDNAPASSVKGEAWRTFV
ATLRNRNIALTAGNTMLTQVVYMGVNIVLPAYLYNIAGLSLAESAGMSVVFTLTGILGQL
VWPSLSDIIGRRTTLIICGLWMAASVGAFYFANTLTLIVVVQLLFGLVANAVWPIYYAVA
CDSAEPSATSTANGIITTAMFIGGGLAPVLMGSLIAMGGGWTTLHGYTVCFFVMAGCALG
GALLQLFSHRPQALVVQLDS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory