Comparing GFF1435 FitnessBrowser__Marino:GFF1435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3mmtA Crystal structure of fructose bisphosphate aldolase from bartonella henselae, bound to fructose bisphosphate (see paper)
54% identity, 95% coverage: 19:353/354 of query aligns to 2:341/341 of 3mmtA
P07764 Fructose-bisphosphate aldolase; EC 4.1.2.13 from Drosophila melanogaster (Fruit fly) (see 2 papers)
53% identity, 93% coverage: 20:348/354 of query aligns to 12:342/361 of P07764
Sites not aligning to the query:
5tklA Crystal structure of fbp aldolase from toxoplasma gondii, condensation intermediate (see paper)
53% identity, 94% coverage: 16:348/354 of query aligns to 8:343/350 of 5tklA
Sites not aligning to the query:
Q9SJQ9 Fructose-bisphosphate aldolase 6, cytosolic; AtFBA6; Cytosolic aldolase 2; cAld2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
52% identity, 94% coverage: 16:349/354 of query aligns to 4:338/358 of Q9SJQ9
6rngB Dipeptide gly-pro binds to a glycolytic enzyme fructose bisphosphate aldolase
53% identity, 93% coverage: 22:349/354 of query aligns to 5:333/334 of 6rngB
4aldA Human muscle fructose 1,6-bisphosphate aldolase complexed with fructose 1,6-bisphosphate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/363 of 4aldA
Sites not aligning to the query:
P04075 Fructose-bisphosphate aldolase A; Lung cancer antigen NY-LU-1; Muscle-type aldolase; EC 4.1.2.13 from Homo sapiens (Human) (see 11 papers)
52% identity, 95% coverage: 16:350/354 of query aligns to 8:345/364 of P04075
Sites not aligning to the query:
5tlhA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 2-naphthol 6-bisphosphonate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/350 of 5tlhA
Sites not aligning to the query:
2ot0A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a c-terminal peptide of wiskott-aldrich syndrome protein (see paper)
52% identity, 95% coverage: 16:353/354 of query aligns to 7:347/356 of 2ot0A
Sites not aligning to the query:
5tlzA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor naphthalene 2,6-bisphosphate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 4:341/346 of 5tlzA
Sites not aligning to the query:
5tlwA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 1-phosphate-benzene 4-bisphosphonate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/349 of 5tlwA
Sites not aligning to the query:
5tleA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 2-phosphate-naphthalene 6-bisphosphonate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/349 of 5tleA
Sites not aligning to the query:
3tu9A Crystal structure of rabbit muscle aldolase bound with 5-o-methyl mannitol 1,6-phosphate (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/349 of 3tu9A
Sites not aligning to the query:
2ot1A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with naphthol as-e phosphate, a competitive inhibitor (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/349 of 2ot1A
Sites not aligning to the query:
P00883 Fructose-bisphosphate aldolase A; Muscle-type aldolase; EC 4.1.2.13 from Oryctolagus cuniculus (Rabbit) (see 5 papers)
52% identity, 95% coverage: 16:350/354 of query aligns to 8:345/364 of P00883
Sites not aligning to the query:
1zalA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/363 of 1zalA
Sites not aligning to the query:
1zajA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
52% identity, 95% coverage: 16:350/354 of query aligns to 7:344/363 of 1zajA
Sites not aligning to the query:
Q944G9 Fructose-bisphosphate aldolase 2, chloroplastic; AtFBA2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
50% identity, 98% coverage: 7:353/354 of query aligns to 38:383/398 of Q944G9
Sites not aligning to the query:
Q9SJU4 Fructose-bisphosphate aldolase 1, chloroplastic; AtFBA1; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
51% identity, 94% coverage: 22:353/354 of query aligns to 54:384/399 of Q9SJU4
Sites not aligning to the query:
2ephD Crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap-tail determined at 2.7 angstrom resolution (see paper)
50% identity, 95% coverage: 14:349/354 of query aligns to 9:347/351 of 2ephD
>GFF1435 FitnessBrowser__Marino:GFF1435
MAGRTTNRLSRINQELTMTIQEELNSTVRELVQPGKGILAADESHPTIAKRFKAVGVESS
EDMRREYRSLIFSASGLGEFISGVILFEETLGQQSLDNVPMPKLLASKGIVPGIKVDKGK
GPLVNAPGDEITFGLDGLEDRLEIYKNQGARFAKWRDVFHISDTLPSRQAIEANAEVLAR
YAAICQSLGIVPIVEPEVLIDGNHSIERCAEVSEAVIREVFHALYRHKVALEYMILKPSM
VTPGKESPKASPEAVATATLDVFRRAVPAAVPGIFFLSGGQTPEEATLNLNAMNSMGAQP
WELSFSYGRALQEPAQKAWAGNLDNGPEAQAAMLKRARLNGAARAGHYRPEMED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory