Comparing GFF1447 FitnessBrowser__WCS417:GFF1447 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 90% coverage: 24:254/257 of query aligns to 1:228/229 of 5t0wA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
30% identity, 89% coverage: 24:253/257 of query aligns to 2:231/237 of 5kkwA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 87% coverage: 32:255/257 of query aligns to 3:227/234 of 3k4uE
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
23% identity, 89% coverage: 26:255/257 of query aligns to 3:228/229 of 6svfA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
22% identity, 87% coverage: 32:255/257 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
22% identity, 87% coverage: 32:255/257 of query aligns to 3:226/226 of 4zv1A
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
24% identity, 98% coverage: 2:254/257 of query aligns to 3:253/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
23% identity, 86% coverage: 34:254/257 of query aligns to 5:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 86% coverage: 34:254/257 of query aligns to 5:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 86% coverage: 34:254/257 of query aligns to 5:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 86% coverage: 34:254/257 of query aligns to 5:231/238 of 1lafE
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
25% identity, 86% coverage: 35:254/257 of query aligns to 6:231/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 86% coverage: 35:254/257 of query aligns to 28:253/260 of P02910
Sites not aligning to the query:
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
30% identity, 34% coverage: 26:113/257 of query aligns to 2:89/130 of 7a99B
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
24% identity, 86% coverage: 34:254/257 of query aligns to 27:253/260 of P0AEU0
Sites not aligning to the query:
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
27% identity, 87% coverage: 24:246/257 of query aligns to 2:227/240 of 4h5fA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
23% identity, 86% coverage: 34:254/257 of query aligns to 2:228/235 of 5owfA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
22% identity, 88% coverage: 26:250/257 of query aligns to 1:227/237 of 4i62A
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
25% identity, 91% coverage: 25:257/257 of query aligns to 1:235/250 of 5lomB
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
26% identity, 87% coverage: 34:257/257 of query aligns to 12:234/243 of 5l9oB
>GFF1447 FitnessBrowser__WCS417:GFF1447
MKAPFALCVLASLATSALADTTPSHLDQVLQRGTLTVCTTGDYKPYTSLRADGSYEGIDI
TMAESLAKSLNAKIQWVPTTWKTLMPDFLAQRCDIAVGGISVSLERQKKAFFSQSLGVDG
KIPLVRCADVQRYQTVDQINQPQVRVIEPAGGTNEVFARAHLGQAQIRLHDNVTIFDELL
AGKADVMITDASEARYQQKLKPGLCAVNPERQMQYSEKAFLLPRDDVAWKNYVDQWLHLS
QATGAYDAIVSQWLATP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory