SitesBLAST
Comparing GFF1448 FitnessBrowser__WCS417:GFF1448 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P78061 Gamma-glutamylputrescine synthetase PuuA; Gamma-Glu-Put synthetase; Glutamate--putrescine ligase; EC 6.3.1.11 from Escherichia coli (strain K12) (see paper)
37% identity, 99% coverage: 5:456/456 of query aligns to 22:472/472 of P78061
- H282 (= H266) mutation to N: Activity is impaired to 9% of wild-type.
- R357 (= R341) mutation to Q: Activity is impaired to 3% of wild-type.
8wwvA Glutamine synthetase
30% identity, 94% coverage: 20:447/456 of query aligns to 29:470/490 of 8wwvA
- binding adenosine-5'-diphosphate: G155 (≠ A142), E157 (= E144), R224 (= R204), F239 (≠ L219), D240 (≠ E220), V241 (≠ H221), H288 (= H268), S290 (= S270), R374 (≠ H351), E376 (= E353)
- binding magnesium ion: E157 (= E144), E236 (= E216)
- binding manganese (ii) ion: E157 (= E144), E159 (= E146), E229 (= E209), E236 (= E216), H286 (= H266), E376 (= E353)
- binding l-methionine-s-sulfoximine phosphate: E157 (= E144), E159 (= E146), E229 (= E209), E236 (= E216), A282 (≠ G262), H286 (= H266), R340 (= R318), K358 (≠ R336)
8wwuB Glutamine synthetase
30% identity, 94% coverage: 20:447/456 of query aligns to 31:472/492 of 8wwuB
- binding phosphoaminophosphonic acid-adenylate ester: G157 (≠ A142), E159 (= E144), R226 (= R204), F241 (≠ L219), V243 (≠ H221), H290 (= H268), S292 (= S270), K360 (≠ R336), R365 (= R341), R376 (≠ H351)
- binding magnesium ion: E159 (= E144), E238 (= E216)
- binding manganese (ii) ion: E159 (= E144), E161 (= E146), E231 (= E209), E238 (= E216), H288 (= H266), E378 (= E353)
8ooqB Glutamine synthetase from Methanothermococcus thermolithotrophicus (see paper)
29% identity, 86% coverage: 60:450/456 of query aligns to 52:439/446 of 8ooqB
Sites not aligning to the query:
8oooA Glutamine synthetase from methanothermococcus thermolithotrophicus in complex with 2-oxoglutarate and mgatp at 2.15 a resolution (see paper)
29% identity, 86% coverage: 60:450/456 of query aligns to 53:440/447 of 8oooA
- binding 2-oxoglutaric acid: R87 (= R97), V93 (≠ A103), P170 (≠ E186), R173 (≠ L189), R174 (≠ A190), S190 (≠ A206)
- binding adenosine-5'-triphosphate: E136 (= E144), E188 (≠ R204), F203 (≠ L219), K204 (≠ E220), F205 (≠ H221), H251 (= H268), S253 (= S270), R325 (= R341), R335 (≠ H351)
Sites not aligning to the query:
P9WN37 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 95% coverage: 19:453/456 of query aligns to 16:444/446 of P9WN37
- K363 (≠ E380) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8tfkA Glutamine synthetase (see paper)
29% identity, 80% coverage: 90:453/456 of query aligns to 73:437/440 of 8tfkA
- binding adenosine-5'-diphosphate: E128 (= E144), D194 (≠ T218), F195 (≠ L219), F197 (≠ H221), N243 (≠ H268), R312 (= R336), R317 (= R341), G325 (≠ S349), R327 (≠ H351)
- binding magnesium ion: E128 (= E144), E128 (= E144), E130 (= E146), E185 (= E209), E192 (= E216), E192 (= E216), H241 (= H266), E329 (= E353)
- binding l-methionine-s-sulfoximine phosphate: E128 (= E144), E130 (= E146), E185 (= E209), E192 (= E216), G237 (= G262), H241 (= H266), R294 (= R318), E300 (≠ Y324), R312 (= R336), R331 (= R355)
8ufjB Glutamine synthetase (see paper)
29% identity, 80% coverage: 90:453/456 of query aligns to 77:441/444 of 8ufjB
A0R083 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 95% coverage: 19:453/456 of query aligns to 16:444/446 of A0R083
- K363 (≠ E380) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7tf6A Glutamine synthetase (see paper)
28% identity, 87% coverage: 61:455/456 of query aligns to 48:437/438 of 7tf6A
- binding glutamine: E128 (= E146), E183 (= E209), G235 (= G262), H239 (= H266), R292 (= R318), E298 (≠ Y324)
- binding magnesium ion: E126 (= E144), E128 (= E146), E183 (= E209), E190 (= E216), H239 (= H266), E327 (= E353)
- binding : F58 (≠ L73), R60 (≠ E76), G232 (≠ D259), N234 (≠ A261), G296 (≠ N322), Y297 (≠ S323), R310 (= R336), Y367 (= Y393), Y421 (≠ Q439), Q433 (≠ W451), Q437 (= Q455)
5dm3C Crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp
32% identity, 78% coverage: 86:440/456 of query aligns to 58:382/396 of 5dm3C
- active site: E115 (= E144), E117 (= E146), E162 (= E209), E169 (= E216), H218 (= H266), R286 (= R336), E303 (= E353), R305 (= R355)
- binding adenosine-5'-diphosphate: R173 (≠ E220), C174 (≠ H221), H220 (= H268), S222 (= S270), R301 (≠ H351)
7tdvC Glutamine synthetase (see paper)
29% identity, 79% coverage: 96:455/456 of query aligns to 76:442/443 of 7tdvC
- binding adenosine-5'-diphosphate: G129 (≠ A142), E131 (= E144), E183 (≠ R204), D197 (≠ T218), F198 (≠ L219), K199 (≠ E220), Y200 (≠ H221), N246 (≠ H268), V247 (= V269), S248 (= S270), R320 (= R341), S328 (= S349), R330 (≠ H351)
- binding magnesium ion: E131 (= E144), E131 (= E144), E133 (= E146), E188 (= E209), E195 (= E216), E195 (= E216), H244 (= H266), E332 (= E353)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E144), E133 (= E146), E188 (= E209), E195 (= E216), G240 (= G262), H244 (= H266), R297 (= R318), E303 (≠ Y324), R315 (= R336)
7cquA Gmas/adp/metsox-p complex (see paper)
30% identity, 86% coverage: 20:412/456 of query aligns to 12:387/429 of 7cquA
- binding adenosine-5'-diphosphate: E121 (= E144), Y173 (≠ R204), N187 (≠ T218), W188 (≠ L219), D189 (≠ E220), Y190 (≠ H221), H236 (= H268), L237 (≠ V269), S238 (= S270), R316 (= R341), R322 (≠ H351)
- binding magnesium ion: E121 (= E144), E121 (= E144), E123 (= E146), E178 (= E209), E185 (= E216), E185 (= E216), H234 (= H266), E324 (= E353)
- binding l-methionine-s-sulfoximine phosphate: E121 (= E144), E123 (= E146), E178 (= E209), E185 (= E216), T229 (≠ A261), G230 (= G262), H234 (= H266), R287 (= R318), W299 (≠ Y324), R311 (= R336), R326 (= R355)
7cqqA Gmas in complex with amppnp and metsox (see paper)
30% identity, 86% coverage: 20:412/456 of query aligns to 12:387/429 of 7cqqA
- binding phosphoaminophosphonic acid-adenylate ester: E121 (= E144), Y173 (≠ R204), E185 (= E216), N187 (≠ T218), D189 (≠ E220), Y190 (≠ H221), H234 (= H266), H236 (= H268), S238 (= S270), R311 (= R336), R316 (= R341), R322 (≠ H351), E324 (= E353)
- binding magnesium ion: E121 (= E144), E121 (= E144), E123 (= E146), E178 (= E209), E185 (= E216), E185 (= E216), H234 (= H266), E324 (= E353)
- binding (2s)-2-amino-4-(methylsulfonimidoyl)butanoic acid: E123 (= E146), E178 (= E209), T229 (≠ A261), H234 (= H266), R287 (= R318), W299 (≠ Y324), R311 (= R336), R326 (= R355)
7cqnA Gmas in complex with amppcp (see paper)
30% identity, 86% coverage: 20:412/456 of query aligns to 12:387/429 of 7cqnA
- binding phosphomethylphosphonic acid adenylate ester: G45 (≠ D67), D61 (= D81), E121 (= E144), Y173 (≠ R204), Q174 (≠ T205), W188 (≠ L219), D189 (≠ E220), Y190 (≠ H221), H236 (= H268), S238 (= S270), R311 (= R336), R316 (= R341), R322 (≠ H351)
7cqwA Gmas/adp complex-conformation 1 (see paper)
30% identity, 86% coverage: 20:412/456 of query aligns to 13:388/430 of 7cqwA
7tenA Glutamine synthetase (see paper)
29% identity, 73% coverage: 119:453/456 of query aligns to 104:439/442 of 7tenA
- binding adenosine-5'-diphosphate: G128 (≠ A142), E130 (= E144), E182 (≠ R204), D196 (≠ T218), F197 (≠ L219), K198 (≠ E220), Y199 (≠ H221), N245 (≠ H268), S247 (= S270), R319 (= R341), S327 (= S349), R329 (≠ H351)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E144), E132 (= E146), E187 (= E209), E194 (= E216), N238 (≠ A261), G239 (= G262), H243 (= H266), R296 (= R318), E302 (≠ Y324), R314 (= R336), R333 (= R355)
7tf9S L. Monocytogenes gs(14)-q-glnr peptide (see paper)
29% identity, 73% coverage: 119:453/456 of query aligns to 105:440/443 of 7tf9S
- binding glutamine: E133 (= E146), Y155 (≠ V176), E188 (= E209), G240 (= G262), G242 (= G264), R297 (= R318), E303 (≠ Y324)
- binding magnesium ion: E131 (= E144), E133 (= E146), E188 (= E209), E195 (= E216), H244 (= H266), E332 (= E353)
- binding : E418 (≠ A431), I422 (≠ A435), M426 (≠ Q439)
Sites not aligning to the query:
8oozA Glutamine synthetase (see paper)
30% identity, 73% coverage: 60:393/456 of query aligns to 46:359/430 of 8oozA
- binding adenosine-5'-triphosphate: G117 (≠ A142), E170 (≠ R204), F185 (≠ L219), K186 (≠ E220), Y187 (≠ H221), N233 (≠ H268), S235 (= S270), S315 (= S349), R317 (≠ H351)
- binding magnesium ion: E119 (= E144), H231 (= H266), E319 (= E353)
8ooxB Glutamine synthetase (see paper)
30% identity, 73% coverage: 60:393/456 of query aligns to 46:367/438 of 8ooxB
Query Sequence
>GFF1448 FitnessBrowser__WCS417:GFF1448
MSVFACLHEAQSFLEQNPDIEMFELFILDNNGVPRGKLLHRDELLAVYESGRPLPSTILG
LTINGDDVENSGLVWEVGDIDCRAYPISGSLQRMPWRLIPTAAVQVSMHLTEGLPATVAD
PRHLLAKVIDALKADGYYPVMAAELEFYLLDQKPDSNGRPQPARDVDGGRPRSTQVYGLR
ELEQIEPFLADLYSACKLQGIPARTAISEYAPGQVEITLEHRSDALQAMDEAVRYKRLVK
GVAHQHGMTACFMAKPFDDLAGTGMHMHVSLADAQGNNLFASEATDGTPLLRQAVGGMLS
TLLDSLLMFCPNANSYRRFQTNSYAPLAATWGVDNRTVSLRVPGGPANSRHIEHRICGAD
ANPYLAAAAILAGIHRGIREQRDPGAPVEGNGYAQATALLPTDWLTTLRALEGSSWAREA
FGTEFLDVYLAVKRAEYRQFMGEVGAQDWRWYLHQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory