SitesBLAST
Comparing GFF1469 FitnessBrowser__Phaeo:GFF1469 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 97% coverage: 3:282/290 of query aligns to 15:293/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ V11), M24 (= M12), N43 (= N31), R44 (= R32), T45 (= T33), K48 (= K36), V77 (= V66), S78 (≠ G67), D82 (= D71), Q85 (≠ S74), V133 (≠ I122), F244 (= F233), K245 (≠ A234), H248 (≠ W237), K251 (= K240)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 97% coverage: 3:282/290 of query aligns to 15:290/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ V11), M24 (= M12), N43 (= N31), R44 (= R32), T45 (= T33), K48 (= K36), M76 (≠ C65), V77 (= V66), S78 (≠ G67), D82 (= D71), Q85 (≠ S74), V133 (≠ I122), F241 (= F233), K242 (≠ A234), H245 (≠ W237), K248 (= K240)
- binding sulfate ion: T134 (≠ S123), G135 (= G124), K183 (= K172)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
30% identity, 99% coverage: 1:286/290 of query aligns to 3:289/294 of 5je8B
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
30% identity, 99% coverage: 1:288/290 of query aligns to 1:287/287 of 3pduA
- binding glycerol: R242 (≠ G243), E246 (≠ D247), E246 (≠ D247), R250 (≠ E251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (≠ V11), M12 (= M12), N31 (= N31), R32 (= R32), N33 (≠ T33), M64 (≠ C65), L65 (≠ V66), A66 (≠ G67), A70 (≠ D71), T96 (= T97), V121 (≠ I122), G123 (= G124), T124 (≠ G125), K171 (= K172), S231 (≠ G232), F232 (= F233), P233 (≠ A234), H236 (≠ W237), K239 (= K240)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
32% identity, 97% coverage: 3:284/290 of query aligns to 3:283/287 of 3pefA
- binding glycerol: D67 (≠ N68), G123 (= G124), K171 (= K172), N175 (≠ Q176), M178 (≠ I179), L203 (≠ V204), G207 (≠ S208), N213 (≠ S214), A217 (= A218), F232 (= F233), H236 (≠ W237), K239 (= K240), R242 (≠ G243), R269 (≠ Q270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (≠ V11), M12 (= M12), N31 (= N31), R32 (= R32), S33 (≠ T33), K36 (= K36), M64 (≠ C65), L65 (≠ V66), A66 (≠ G67), A70 (≠ D71), E73 (≠ S74), T96 (= T97), V121 (≠ I122), G123 (= G124), S124 (≠ G125), A231 (≠ G232), F232 (= F233), H236 (≠ W237), K239 (= K240)
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 97% coverage: 3:284/290 of query aligns to 8:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G10), L16 (≠ V11), M17 (= M12), N36 (= N31), R37 (= R32), T38 (= T33), V70 (= V66), S71 (≠ G67), A75 (≠ D71), T101 (= T97), F237 (= F233), Y238 (≠ A234), Y241 (≠ W237), K244 (= K240)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 99% coverage: 1:287/290 of query aligns to 1:287/298 of P0A9V8
- QM 11:12 (≠ VM 11:12) binding
- D31 (≠ N31) binding
- L65 (≠ V66) binding
- T96 (= T97) binding
- G122 (≠ S123) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G124) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G125) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQIAI 175:179) binding
- K240 (= K240) binding
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 97% coverage: 3:284/290 of query aligns to 269:549/553 of Q49A26
- 271:285 (vs. 5:19, 47% identical) binding
- T362 (= T97) binding
- M437 (≠ I177) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ H231) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K240) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
28% identity, 99% coverage: 4:290/290 of query aligns to 41:333/335 of P29266
- D68 (≠ N31) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K172) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q176) mutation to Q: Decrease in activity.
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 99% coverage: 2:287/290 of query aligns to 1:286/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 99% coverage: 2:287/290 of query aligns to 1:286/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ V11), M11 (= M12), F29 (≠ Y30), D30 (≠ N31), V31 (≠ T33), M63 (≠ C65), L64 (≠ V66), V73 (= V75), S94 (≠ T96), T95 (= T97), R122 (≠ G124)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
32% identity, 93% coverage: 1:271/290 of query aligns to 1:265/289 of 2cvzC
- active site: S117 (= S123), K165 (= K172), N168 (= N175), N169 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (= L9), G10 (= G10), A11 (≠ V11), M12 (= M12), N30 (= N31), R31 (= R32), T32 (= T33), C62 (= C65), L63 (≠ V66), P64 (≠ G67), E68 (≠ D71), E71 (≠ S74), S91 (≠ T97), V116 (≠ I122), F227 (= F233), K234 (= K240)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
32% identity, 93% coverage: 3:271/290 of query aligns to 2:264/288 of 1wp4A
- active site: S116 (= S123), K164 (= K172), N167 (= N175), N168 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (= L9), G9 (= G10), A10 (≠ V11), M11 (= M12), N29 (= N31), R30 (= R32), T31 (= T33), K34 (= K36), C61 (= C65), L62 (≠ V66), P63 (≠ G67), E67 (≠ D71), S90 (≠ T97), V115 (≠ I122), T225 (≠ G232), F226 (= F233), K233 (= K240)
- binding sulfate ion: S116 (= S123), G117 (= G124), G118 (= G125), K164 (= K172)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
27% identity, 97% coverage: 3:284/290 of query aligns to 268:542/546 of Q922P9
- P489 (≠ H231) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
27% identity, 99% coverage: 4:290/290 of query aligns to 3:295/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (≠ V11), M11 (= M12), Y29 (= Y30), D30 (≠ N31), V31 (≠ R32), M63 (≠ C65), L64 (≠ V66), P65 (≠ G67), T95 (= T97), V120 (≠ I122), G122 (= G124), F238 (= F233), K245 (= K240)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
27% identity, 99% coverage: 4:290/290 of query aligns to 42:334/336 of P31937
- LP 103:104 (≠ VG 66:67) binding
- N108 (≠ D71) binding
- T134 (= T97) binding
- K284 (= K240) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
33% identity, 89% coverage: 1:258/290 of query aligns to 1:261/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ V133), E149 (≠ G153), A152 (= A156), G153 (≠ R157), G153 (≠ R157), K154 (≠ I158)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S123), G120 (= G124), W211 (= W215), F236 (= F233)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G10 (= G10), N11 (≠ V11), M12 (= M12), F30 (≠ Y30), D31 (≠ N31), P32 (≠ T33), M64 (≠ C65), L65 (≠ V66), T93 (= T97), G121 (= G125), K168 (= K172), L240 (≠ W237), K243 (= K240)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
33% identity, 89% coverage: 1:258/290 of query aligns to 1:261/290 of 5y8kA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
33% identity, 88% coverage: 4:258/290 of query aligns to 3:260/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
33% identity, 88% coverage: 4:258/290 of query aligns to 3:260/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ E149), E148 (≠ G153), A151 (= A156), K153 (≠ I158)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G9 (= G10), N10 (≠ V11), M11 (= M12), F29 (≠ Y30), D30 (≠ N31), P31 (≠ T33), M63 (≠ C65), L64 (≠ V66), G120 (= G125), L239 (≠ W237), K242 (= K240)
Query Sequence
>GFF1469 FitnessBrowser__Phaeo:GFF1469
MAKVAFLGLGVMGYPMAGHLAAAGHEVTVYNRTAAKAEAWAKEHGGTAAATPREAAAGAE
FVMACVGNDDDLRSVCLGDTGAFGGMGAGAIFVDHTTVSAKVTRELNAAAADLGLSFVDA
PISGGQAGAENGVLSVMCGGDQAAYDKAEPVIGSYARICRRIGDSGAGQMTKMCNQIAIA
GLVQGLSEALHFAEKAGLDGRAVVEVISQGAAGSWQMANRHETMLDDHFDHGFAVDWMRK
DLGICLDAAEETGASLPVTALVDQFYKDVQKLGGGRWDTSSLFKRLKAFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory