SitesBLAST
Comparing GFF148 FitnessBrowser__psRCH2:GFF148 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 85% coverage: 1:220/260 of query aligns to 1:217/393 of P9WQI3
- H193 (= H196) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 83% coverage: 4:220/260 of query aligns to 3:245/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7aheC Opua inhibited inward facing (see paper)
37% identity, 83% coverage: 4:220/260 of query aligns to 3:245/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
36% identity, 83% coverage: 4:220/260 of query aligns to 3:245/260 of 7ahdC
- binding adenosine-5'-triphosphate: F12 (= F13), T39 (vs. gap), S61 (= S42), G62 (= G43), G64 (= G45), K65 (= K46), S66 (= S47), T67 (= T48), Q111 (= Q83), K161 (≠ Q136), Q162 (≠ E137), S164 (= S139), G166 (= G141), M167 (= M142), Q188 (≠ E163), H221 (= H196)
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
40% identity, 88% coverage: 1:230/260 of query aligns to 4:220/353 of 1vciA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 78% coverage: 23:225/260 of query aligns to 22:230/375 of 2d62A
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 83% coverage: 6:220/260 of query aligns to 5:214/384 of 8hplC
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 17:228/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 17:228/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S42), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), Q81 (= Q83), R128 (≠ K133), A132 (≠ E137), S134 (= S139), G136 (= G141), Q137 (≠ M142), E158 (= E163), H191 (= H196)
- binding magnesium ion: S42 (= S47), Q81 (= Q83)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 17:228/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K133), S134 (= S139), Q137 (≠ M142)
- binding beryllium trifluoride ion: S37 (= S42), G38 (= G43), K41 (= K46), Q81 (= Q83), S134 (= S139), G136 (= G141), H191 (= H196)
- binding magnesium ion: S42 (= S47), Q81 (= Q83)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 17:228/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (= V22), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K133), A132 (≠ E137), S134 (= S139), Q137 (≠ M142)
- binding tetrafluoroaluminate ion: S37 (= S42), G38 (= G43), K41 (= K46), Q81 (= Q83), S134 (= S139), G135 (= G140), G136 (= G141), E158 (= E163), H191 (= H196)
- binding magnesium ion: S42 (= S47), Q81 (= Q83)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 17:228/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (= V22), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ K133), A132 (≠ E137), S134 (= S139), Q137 (≠ M142)
- binding magnesium ion: S42 (= S47), Q81 (= Q83)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
39% identity, 82% coverage: 22:234/260 of query aligns to 15:226/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S42), G36 (= G43), C37 (= C44), G38 (= G45), K39 (= K46), S40 (= S47), T41 (= T48), R126 (≠ K133), A130 (≠ E137), S132 (= S139), G134 (= G141), Q135 (≠ M142)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 82% coverage: 22:234/260 of query aligns to 18:229/371 of P68187
- A85 (≠ S86) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ F105) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I118) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ N121) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A123) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ G128) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G141) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D162) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R233) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1g291 Malk (see paper)
37% identity, 78% coverage: 23:225/260 of query aligns to 19:227/372 of 1g291
- binding magnesium ion: D69 (≠ G73), E71 (≠ G75), K72 (≠ P76), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S42), G39 (= G43), C40 (= C44), G41 (= G45), K42 (= K46), T43 (≠ S47), T44 (= T48)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
37% identity, 76% coverage: 23:220/260 of query aligns to 19:216/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S42), C40 (= C44), G41 (= G45), K42 (= K46), S43 (= S47), T44 (= T48), Q82 (= Q83), R129 (≠ K133), Q133 (≠ E137), S135 (= S139), G136 (= G140), G137 (= G141), Q159 (≠ E163), H192 (= H196)
- binding magnesium ion: S43 (= S47), Q82 (= Q83)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
37% identity, 76% coverage: 23:220/260 of query aligns to 19:216/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S42), G39 (= G43), G41 (= G45), K42 (= K46), S43 (= S47), Q82 (= Q83), Q133 (≠ E137), G136 (= G140), G137 (= G141), Q138 (≠ M142), H192 (= H196)
- binding magnesium ion: S43 (= S47), Q82 (= Q83)
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 85% coverage: 1:221/260 of query aligns to 1:224/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 85% coverage: 1:221/260 of query aligns to 1:224/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 85% coverage: 1:221/260 of query aligns to 1:224/353 of 1oxuA
Query Sequence
>GFF148 FitnessBrowser__psRCH2:GFF148
MSYLSIEHLDKSFVRGNLASQVLKDINLNIAKGEFISIIGHSGCGKSTVLNIVAGLLDPS
LGGVILDGKEVRGPGPDRSMVFQNHSLLPWLTVYENVEVAVNKLFKRSMNKRERREWIEH
NLALVNMGHALNKYPQEISGGMKQRVGIARALAMKPKVLLLDEPFGALDALTRAHLQDEV
MKIQKDLGNTMMMITHDVDEAVLLSDRIVMMTNGPSATIGEILEVKLPRPRDRIALADDP
EYNHYRRAVLSFLHERHRLH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory