SitesBLAST
Comparing GFF1489 PS417_07575 multifunctional fatty acid oxidation complex subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
93% identity, 100% coverage: 1:715/715 of query aligns to 1:715/715 of 1wdlA
- active site: A69 (= A69), N89 (= N89), N93 (= N93), G117 (= G117), E120 (= E120), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S430), H451 (= H451), E463 (= E463), N501 (= N501)
- binding nicotinamide-adenine-dinucleotide: A322 (= A322), I324 (= I324), M325 (= M325), D344 (= D344), I345 (= I345), A400 (= A400), V401 (= V401), E403 (= E403), N428 (= N428), T429 (= T429), S430 (= S430)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
93% identity, 100% coverage: 1:715/715 of query aligns to 1:715/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
92% identity, 100% coverage: 1:715/715 of query aligns to 1:707/707 of 1wdmA
- active site: A69 (= A69), N89 (= N89), N93 (= N93), G117 (= G117), E120 (= E120), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S430), H451 (= H451), E463 (= E463), N501 (= N501)
- binding acetyl coenzyme *a: K142 (= K142), D297 (= D297), M459 (= M459), N501 (= N501), P534 (= P534), Y652 (= Y660), L658 (≠ P666)
- binding nicotinamide-adenine-dinucleotide: G321 (= G321), A322 (= A322), I324 (= I324), M325 (= M325), D344 (= D344), V401 (= V401), E403 (= E403), N428 (= N428), S430 (= S430), N454 (= N454)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
58% identity, 100% coverage: 1:714/715 of query aligns to 1:714/729 of P21177
- G116 (= G117) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G323) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H451) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
58% identity, 100% coverage: 1:714/715 of query aligns to 1:714/719 of 6tnmA
- active site: A68 (= A69), F73 (= F74), G116 (= G117), E119 (= E120), P138 (= P139), E139 (= E140), G147 (= G148), N271 (≠ E272), S429 (= S430), H450 (= H451), E462 (= E463), N500 (= N501)
- binding adenosine-5'-triphosphate: D343 (= D344), I344 (= I345), V400 (= V401), V401 (= V402), V406 (= V407), K584 (= K584)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
36% identity, 99% coverage: 7:714/715 of query aligns to 3:703/707 of 6yswA
- active site: A66 (= A69), I71 (≠ F74), A84 (= A87), Q88 (≠ N93), G112 (= G117), E115 (= E120), P136 (= P139), E137 (= E140), G145 (= G148), D264 (≠ E272), S422 (= S430), H443 (= H451), E455 (= E463), N493 (= N501)
- binding coenzyme a: E23 (= E27), M25 (≠ V29), A66 (= A69), D67 (= D70), I68 (= I71), P136 (= P139), E137 (= E140), L140 (= L143), T290 (≠ Q298), K293 (= K301)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 96% coverage: 29:714/715 of query aligns to 61:761/763 of P40939
- V282 (≠ S233) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I256) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L293) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E463) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
33% identity, 93% coverage: 50:715/715 of query aligns to 41:692/692 of 6iunB
- active site: A60 (= A69), F65 (= F74), E73 (≠ D82), H77 (≠ N93), G101 (= G117), E104 (= E120), E124 (= E140), G132 (= G148), K248 (≠ E272), S407 (= S430), H428 (= H451), E440 (= E463), N478 (= N501)
- binding nicotinamide-adenine-dinucleotide: G300 (= G323), T301 (≠ I324), M302 (= M325), E321 (≠ D344), T322 (≠ I345), Y365 (= Y388), A377 (= A400), V378 (= V401), E380 (= E403), V384 (= V407), V388 (= V411), N405 (= N428), S407 (= S430)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 95% coverage: 16:691/715 of query aligns to 23:714/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G68), F169 (≠ I159), N173 (= N163), S177 (≠ E166), I193 (≠ V182), F313 (≠ L295)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ F32), N40 (= N33), E41 (≠ R34), T81 (≠ E73), D92 (≠ L85), V93 (= V86)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ F32), G77 (≠ A69), D78 (= D70), M82 (≠ F74), V93 (= V86)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ K142), R184 (≠ E173), A311 (≠ L293), F312 (= F294), I673 (≠ M656)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
34% identity, 95% coverage: 16:691/715 of query aligns to 24:715/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ F32), N41 (= N33), E42 (≠ R34), G77 (= G68), G78 (≠ A69), D79 (= D70), V80 (≠ I71), D90 (= D82), V94 (= V86), L124 (= L115), G125 (= G116), P150 (= P139), E151 (= E140)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
34% identity, 95% coverage: 16:691/715 of query aligns to 23:714/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ R34), G76 (= G68), G77 (≠ A69), D78 (= D70), V79 (≠ I71), M82 (≠ F74), D89 (= D82), V93 (= V86), T96 (≠ N89), T96 (≠ N89), P149 (= P139), E150 (= E140)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
34% identity, 95% coverage: 16:691/715 of query aligns to 23:714/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ F32), M82 (≠ F74), E150 (= E140), Q172 (≠ D162), F175 (vs. gap), V176 (≠ I165), Q181 (≠ A170), T241 (≠ E221), F254 (= F234), N257 (≠ G239), Q261 (≠ G243), L262 (≠ Q244), P266 (≠ N248), P268 (= P250), Q282 (≠ N264), V283 (≠ F265), G302 (≠ T284), Q303 (≠ S285), V304 (≠ A286), S521 (≠ N501), G525 (≠ F505)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
34% identity, 95% coverage: 16:691/715 of query aligns to 23:714/729 of 8opvA
- binding resveratrol: M39 (≠ F32), A75 (≠ V67), G76 (= G68), M82 (≠ F74), E128 (= E120), P149 (= P139), E150 (= E140), T152 (≠ K142), L153 (= L143), R184 (≠ E173), F296 (= F278)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
34% identity, 95% coverage: 16:691/715 of query aligns to 23:714/729 of 8opuA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
34% identity, 95% coverage: 16:691/715 of query aligns to 29:720/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (≠ F32), I50 (≠ L37), G82 (= G68), G83 (≠ A69), D84 (= D70), T87 (≠ E73), T87 (≠ E73), M88 (≠ F74), M88 (≠ F74), A91 (≠ N77), D95 (= D82), D98 (≠ L85), V99 (= V86), T102 (≠ N89), T102 (≠ N89), E134 (= E120), E156 (= E140), L159 (= L143), F302 (= F278), F302 (= F278), F319 (≠ L295), S456 (= S430), T457 (= T431), M485 (= M459), P486 (= P460), G523 (= G497), S527 (≠ N501), N535 (≠ G509), P560 (= P534), M575 (≠ G549), I578 (≠ G552), I578 (≠ G552), I682 (≠ V659), M683 (≠ Y660), G686 (= G663)
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
34% identity, 95% coverage: 16:691/715 of query aligns to 12:696/711 of 7o4uA
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
34% identity, 95% coverage: 16:691/715 of query aligns to 21:712/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ R34), G74 (= G68), M80 (≠ F74), V91 (= V86), T94 (≠ N89), T94 (≠ N89), E148 (= E140), L151 (= L143), R182 (≠ E173), S448 (= S430), S519 (≠ N501), R520 (= R502), L562 (≠ V544), L566 (≠ T548), I570 (≠ G552)
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 95% coverage: 16:691/715 of query aligns to 22:713/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ K31), N39 (= N33), G75 (= G68), D77 (= D70), M81 (≠ F74), V92 (= V86), T95 (≠ N89), P148 (= P139), E149 (= E140), L152 (= L143), Q180 (≠ A170), Q260 (≠ G243), K362 (= K343), D363 (= D344), V364 (≠ I345), V430 (= V411), D476 (≠ H457), K477 (≠ M458), M478 (= M459), P479 (= P460), K506 (= K487)
- binding formamide: V78 (≠ I71), K79 (≠ T72)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
34% identity, 95% coverage: 16:691/715 of query aligns to 22:713/727 of 8oqoA
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 95% coverage: 16:691/715 of query aligns to 17:708/723 of 8oqqA
Query Sequence
>GFF1489 PS417_07575 multifunctional fatty acid oxidation complex subunit alpha
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADFRVMSATAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENKAEDAL
KVGAVDAVVAPDKLAEAALNLIKGAISGEFDYKAKRQPKLEKLKLNAIEQMMSFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEAQVK
DDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQ
KKVADPSVHEVLAPVIYEQREVSDEDIINWMMIALCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHPTAKLREMAKNGQSFFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory