Comparing GFF1491 FitnessBrowser__psRCH2:GFF1491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
69% identity, 99% coverage: 2:186/186 of query aligns to 1:185/187 of 8gxfB
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
68% identity, 99% coverage: 2:185/186 of query aligns to 1:184/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
68% identity, 99% coverage: 2:185/186 of query aligns to 1:184/187 of 1yreB
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
26% identity, 67% coverage: 55:178/186 of query aligns to 72:194/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
26% identity, 67% coverage: 55:178/186 of query aligns to 72:194/209 of 6c32A
Sites not aligning to the query:
>GFF1491 FitnessBrowser__psRCH2:GFF1491
MFSPHPVTLQRGALRLAPLMEADIPELVALAERNRAELTFMNGPLRPDWYRHALAEQRDG
HAVVFSIRMAERLIGTTRFADFVSSLPAAELGWTWLDQAEHGTGLNASIKFLLLRHAFEE
WQLVRLQLKTAASNLRSQRAIEKLGAQREGVLRNHRRLADGRLDDTVLYSITDRDWPQVR
QCLAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory