Comparing GFF1532 FitnessBrowser__Phaeo:GFF1532 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
42% identity, 99% coverage: 4:366/368 of query aligns to 1:364/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
42% identity, 98% coverage: 6:366/368 of query aligns to 1:362/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 98% coverage: 6:366/368 of query aligns to 1:322/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 98% coverage: 6:366/368 of query aligns to 1:320/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
36% identity, 63% coverage: 8:240/368 of query aligns to 1:219/241 of 2akoA
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
40% identity, 49% coverage: 2:183/368 of query aligns to 7:182/236 of 7f5xA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 49% coverage: 2:183/368 of query aligns to 7:195/258 of 7wx3B
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
35% identity, 22% coverage: 153:233/368 of query aligns to 121:198/226 of 2bmuB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
35% identity, 22% coverage: 153:233/368 of query aligns to 120:197/225 of Q8U122
Sites not aligning to the query:
>GFF1532 FitnessBrowser__Phaeo:GFF1532
MATLTDAQRIVVKIGSALLVDRTSGALRADWLRALAADVAWLKSMGKDVILVSSGSIALG
RRVLGLAAQELPLEQSQAAAAVGQIRLAGAYEEALAPHEITTAQVLVTLEDSADRRRYLN
SRATLETLIGLGVVPIVNENDTIATDEIRYGDNDRLAAQVAVTVGADALILLSDVDGFYT
ANPVLDPTARRYDIIDRITPEIEAMAGDGVSGLSKGGMITKLLAAKMATAAGCAMAITEG
SPNNPLKLLENGAPSTWFTAQDDPQVARKRWIAAMKTRGVVAVDEGAARALGSGKSLLPA
GIRHIEGDFGRGDPLAILGPDGRKLGQGLSRYTAEEASAIKGCQSTEIEAILGYAGRAAV
IHRDDMAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory