Comparing GFF1533 FitnessBrowser__Phaeo:GFF1533 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
37% identity, 96% coverage: 14:416/421 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
37% identity, 96% coverage: 14:416/421 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 97% coverage: 4:413/421 of query aligns to 1:407/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
26% identity, 39% coverage: 114:278/421 of query aligns to 103:268/456 of 5j7iB
Sites not aligning to the query:
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
26% identity, 39% coverage: 114:278/421 of query aligns to 102:267/455 of 5j7iC
>GFF1533 FitnessBrowser__Phaeo:GFF1533
MNETQDISALMADIGKRAKQAAAKLATATAERKADALNAAADAVWDARAEILGANAKDLD
FGRNKGLSPAMMDRLALDEDRISGIVAGLRAVAAQPDPVGEVLAEWSQPSGLDIQRVRTP
LGVIGVIYESRPNVTADAGALCLKSGNAVILRGGSESFYSSQAIHGCLAAGLRAADLPED
AIQLVPTRDRAAVQELLTMTDTVDVIVPRGGKGLVGLVQREARVPVFAHLEGIVHIYLDK
DADPQKALEIVLNAKTRRTGICGAAECLLIHRDIAETIGRDVLTALATAGVEIRAEAGLP
GPDGMTAATSADWGCEYLDAIIAAKQVDDIDAAIDHIRTHHSQHTDCIITENDSAVAQFF
AELDSAILMHNASTQFADGGEFGMGAEIGIATGKMHARGPVGAAQLTSFKYLVRGHGALR
S
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory