Comparing GFF1547 FitnessBrowser__psRCH2:GFF1547 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
27% identity, 67% coverage: 67:369/452 of query aligns to 66:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
27% identity, 67% coverage: 67:369/452 of query aligns to 66:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
27% identity, 67% coverage: 67:369/452 of query aligns to 66:407/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
27% identity, 67% coverage: 67:369/452 of query aligns to 70:411/491 of P0AGF4
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 52% coverage: 25:259/452 of query aligns to 56:276/444 of Q8NLB7
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 42% coverage: 8:198/452 of query aligns to 1:192/433 of 8fvzA
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 47% coverage: 9:222/452 of query aligns to 36:262/583 of Q9Y7Q9
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 68% coverage: 73:380/452 of query aligns to 63:390/446 of A0A0H2VG78
Sites not aligning to the query:
>GFF1547 FitnessBrowser__psRCH2:GFF1547
MSNSTAAPRKNQVLAAVIGNALEWYDFIVFGFLAVVISRLFFPAESEYSALLMATATFGV
GFFMRPIGGVLLGIYADRKGRKAALQLIISLMTLSIAMIAFAPPFAAIGIAAPLLIVLAR
LMQGFATGGEFASATSFLIESAPANRRGLYGSWQMFGQGLAVFCGAGVTALVTSNLSPED
LDSWGWRIPFIIGLIIGPVGLWMRRNLSETEAFLEARQAPKEKQSLARMLRSHLRQVVTV
MALTVCGTVAFYVILVYMPTFANRQLGMQLKDAFTAQVVAVAVLTLLMPVFGALSDRVGR
KLLMIVATLGLLVALYPLFSWIHAAPSFGRLLTMQLILCSLLAVFFGPFSAAVAEQFPAG
VRSTGLALAYNLAVMIFGGFAQFIVTWLIQNTGMAIAPVFYVLFAVTLGLIGSFFLIDRT
HEAHLAVVDESSPLKAAAQPTGTLNRVVAQGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory